KEGG   Corynebacterium ulcerans 0102: CULC0102_2013Help
Entry
CULC0102_2013     CDS       T02171                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cue00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2180038..2180601)
Genome map
AA seq 187 aa AA seqDB search
MFDRDRAEAAVRELLIAVGEDPDREGLQETPARVAKAYAEVFAGLHTDPTEVLNKTFSED
HRELVLVRDIPIYSTCEHHLVPFFGTAHIGYIPGQSGKVTGLSKLARLVDLYAKRPQVQE
RLTSQVADALVEKLEAQAVIVVIECEHLCMAMRGIRKPGATTTTSAVRGGFQTNAASRAE
VLSLIRS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgatcgcgatcgcgcagaagcagcagtccgggaacttcttattgcggtgggcgag
gacccggatcgtgaaggactccaagaaacaccggcgcgtgtggcaaaggcgtatgcagag
gtctttgccggcctgcacacggaccctacggaggtcttgaacaagaccttcagcgaggat
caccgtgagctagtactggttcgagatattccgatctactcaacgtgcgagcaccacctg
gtgcccttctttggcacggcgcacatcggatacattccgggacagtccgggaaagtaacg
ggtctgtctaagttggcgcgtttggtggatctgtatgccaagcgtccccaggtacaggaa
cgattaacctctcaggtagccgatgccctggtagaaaagctggaagctcaggccgtgatc
gtggtgatcgaatgtgagcacctgtgcatggcgatgcgtggcatacgtaagccaggagcc
accaccaccacatctgcggttcgaggaggtttccaaaccaacgcggcctcccgtgcggag
gttttgagccttattcggagctga

DBGET integrated database retrieval system