KEGG   Corynebacterium variabile: CVAR_2521Help
Entry
CVAR_2521         CDS       T01594                                 

Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
cva  Corynebacterium variabile
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cva00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CVAR_2521
DNA repair and recombination proteins [BR:cva03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CVAR_2521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2846318..2846908)
Genome map
AA seq 196 aa AA seqDB search
MGPKSAQRIAFHLLQAEPTDVERLAGALTRLQQGVHFCRICHNISSEDVCRICADSSRDA
TLVCVVEESKDIQVIERTGEYKGRYHVLGGALDPLNGIGPKELNVTALVQRIGGRVDDVP
AADGTLPDAPDISEVIIATDPNTEGEATASYLGRLLKDFPGLTVSRLASGIPMGGDLEFV
DELTLSRAFEGRTPLG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccgaaaagtgcacagcgcatcgccttccacctgctgcaggcggagccgacggac
gtcgagcgcctcgccggcgcgctgacgcgtctgcagcagggtgtgcacttctgccgtatc
tgccacaacatctcgtccgaggacgtctgccgcatctgcgcggattcctcgcgggacgcc
acgctcgtctgcgtcgtcgaggagtccaaggacatccaggtcatcgagcgcaccggtgag
tacaaggggcgctaccacgtcctcggcggggcactcgacccgctcaacggcatcgggccg
aaggagctcaacgtcaccgcactggtgcagcgcatcggtggccgggtcgatgacgtcccg
gcagccgacggcacgctgccggacgccccggacatcagcgaggtcatcatcgccacggac
ccgaacaccgagggggaggccacggcgtcctacctgggacgcctgctcaaggacttcccc
gggctgactgtctcccggctggcctcgggtatcccgatgggcggcgacctggagttcgtc
gacgagctgacgctctcccgggccttcgaggggcggacgccgctcgggtga

DBGET integrated database retrieval system