KEGG   Chlorella variabilis: CHLNCDRAFT_57929Help
Entry
CHLNCDRAFT_57929  CDS       T02924                                 

Definition
hypothetical protein
Orthology
K14272  
glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44 2.6.1.-]
Organism
cvr  Chlorella variabilis
Pathway
Alanine, aspartate and glutamate metabolism
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Photorespiration
Class
Metabolism; Overview; Carbon metabolism [PATH:cvr01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:cvr01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cvr01230]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cvr00630]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:cvr00710]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cvr00250]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cvr00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 529 aa AA seqDB search
MCMLCVARKGSALSSGARQLLSNWQCPVKASGSQLAQGRLFSSLPEPAHEPTRPNEVEGK
VAHPSLLNEDLLKAEYAVRGELYNKAMELQKQGRELIFTNVGNPQQLGQQPITFNRMVTS
LVAAPFLMGHPSAPSMFPADVLERAKKINGMFGGALGAYTDSRGNAGVRQEVADFIKQRD
GYPSNPDNIFLTDGASVAVRLLLNALIRDSSDAILVPIPQYPLYSASIQLYGGTLLPYNL
KEQTGWSMDFNEISRSVHDARNHGTNVRAMVFINPGNPTGQCLTEDNLRDLVRFAAKEKV
VLMADEVYQPNIYQDEKPFVSAKKVLGDLGKPISDSVELASFHTVSKGVLGECGLRGGYV
ELTNFHPGTVDELYKAVSINLSPNTTGQVAMSLMVNPPKPGDESYAQWKAEHDEGLASLR
RRAHAMTDGFNALDGVTCTFTEGAMYSFPRLHLPPKAIAAAAAAGKPADTFYCLQLLEAT
GIVTVPGSGFGQEEGTFHLRTTILPPEAKIGEFVKLFQDFHKAFMAKYA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtgtatgctctgtgttgcccgcaagggctccgccctctcaagcggtgctcgccagctg
ctgagcaactggcagtgcccagtgaaggcttctggctcccagctggcccagggacggctc
ttcagcagcctgcccgagcctgcgcacgagcccacccgcccgaacgaagtggagggcaag
gtggcccacccctccctgctgaatgaggacctgctcaaggcggagtatgccgtgcgtggg
gagctgtacaacaaggcgatggagctgcagaagcaggggcgcgagctgatcttcaccaac
gtgggcaacccgcagcagctgggccagcagcccatcaccttcaaccgcatggtcacctcg
ctggtggcggcgcccttcctgatgggtcacccctcggcgccctccatgttccccgcggac
gtgctggagcgggccaagaagatcaacggcatgtttggcggcgcgctcggcgcctacacc
gactcgcgcggcaacgccggtgtgcgccaggaggtggccgacttcatcaagcagcgcgac
ggttacccctccaacccagacaacatcttcctcaccgacggcgccagcgtggcggtgcgc
ctgctgctcaacgcgctcatccgcgacagcagcgacgccatcctggtgcccatcccgcag
tacccgctgtactcagcctccatccagctctacggcggcacgctgctgccgtacaacctc
aaggagcagacggggtggagcatggacttcaacgagatcagccgcagcgtgcacgacgcg
cgcaaccacggcaccaacgttcgcgccatggtgttcatcaacccgggcaaccccaccggc
cagtgcctgaccgaggacaacctgcgcgacctggtgcgctttgccgccaaggagaaggtg
gtgcttatggcggatgaggtctaccagcccaacatctaccaggacgagaagccgtttgtg
agcgccaagaaggtgctgggcgacctgggcaagcccatcagcgacagcgtggagctggcc
tccttccacaccgtgtccaagggcgtgctgggcgagtgcggcctgcggggcgggtatgtg
gagctcaccaacttccacccgggcaccgtggacgagctttacaaggccgtctccatcaac
ctgtcccccaacaccaccggccaggtggccatgagcctgatggtcaacccgcccaagccc
ggcgacgagagctacgcgcagtggaaggcggagcacgacgagggcctggcctcgctgcgg
cgccgcgcccacgccatgaccgacggcttcaacgccctggacggcgtgacctgcaccttc
acagagggagccatgtactccttcccccgcctccacctgccgcccaaggccatcgccgcc
gccgccgccgccggcaagcccgccgacaccttctactgcctgcagctgctggaggccacg
ggcatcgtcaccgtgcccggcagcggctttgggcaggaggagggcaccttccacctgcgc
accaccatcctgccgcccgaggccaagatcggcgagtttgtgaagctgttccaggacttc
cacaaggccttcatggccaagtacgcctga

DBGET integrated database retrieval system