KEGG   Corynebacterium vitaeruminis: B843_04010Help
Entry
B843_04010        CDS       T03042                                 

Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cvt  Corynebacterium vitaeruminis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cvt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B843_04010
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B843_04010
  Energy metabolism
   00680 Methane metabolism
    B843_04010
Enzymes [BR:cvt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B843_04010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
848659..851265
Genome map
AA seq 868 aa AA seqDB search
MLGRVIAQQEGEDVFELVEATRRMAFDIAHGDAKPTDLMGIFRDLDITKTNLVARSFCYF
ALIANLAEDLADESVEAPVSLRKTFAKLKDAGVTGADAAAVVRNAKVAPVLTAHPTETRR
RTVFDTQNRIKQLLKESHHGGDMARIEREMYLRITLLWQTALIRIARPTLEDEVDVGLRY
YKLSLLEQVPALNRAIRHNMRDTFGMQVPDVPVVRPGSWIGGDHDGNPYVNARTLTYATR
NAAKTVLRFYEEQLGELERELSLSDRYSSCSKELLALADAAHNDWESRVDEPYRRAIYGI
RNRVRANLHEIGDKKVAQVDAAAYASPEEFKRDLDTIDRSLRQFNDDVIADDRLARIRSA
VTTFGFHLYTLDLRQNSESFENVLTEVFAAAGRSDDYRALGEEEKIALLVEELKTPRPLL
FPDAAPMSEVTEKELGIFRAAAQAVRNFGPQSVSHCIISMTGTVSDILEPMVLLKEVGLR
EVDVVPLFETIDDLKAGAGILEKLWSVPFYREHLRARGDVQEVMLGYSDSNKDGGYLQAN
WALYDAELALVELCNAHGIELRLAHGRGGAVGRGGGPTYDAILAQPKGAVSGSVRITEQG
EVISAKYGAPETARRHLEAFVSGALVASLTDTEPIADPDRAYAIMRELSDLSGQKYQELV
GDPGFIEYFTQSTPLHEIGDLNLGSRPAARKQTTAISDLRAIPWVLSWSQSRTNVPGWFG
VGSAVTRWAGEDASRWEELRALHRDWPFFRSVMSNMAQVMAKAEISLARLYANLVDDKQI
ADRIYTLIAEEFELTKKVYLEVTGNKDLTAENQRQARSLKRRYPYLLPLNAIQLELLRRY
RAGDDSFLVSKTIQVTMNGLATALRNAG
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
gtgctggggcgggtgatcgcgcagcaggagggcgaggacgtattcgagctggtcgaggcc
acccgccggatggccttcgacatcgcccacggcgacgccaagcccacggacttgatgggt
atcttccgcgacctggacatcaccaagaccaacctggtcgcgcgctcgttttgctacttc
gcgctgatcgccaacctcgccgaggacctggccgacgagtccgtcgaggcgccggtgtct
ttgcgcaagacgttcgcgaagctcaaggacgcgggcgtgaccggcgccgacgccgccgcc
gtcgtccgcaacgccaaggtcgccccggtgctcaccgcgcacccgaccgagacccgccgc
cgcaccgtcttcgacacccaaaaccgcatcaagcagctgctcaaggagtcccaccacggt
ggcgacatggcacgcatcgagcgcgagatgtacctgcgcatcacgctgctgtggcagacc
gcgctcattcgcatcgcccgccccaccctggaggacgaggtggacgtggggctgcgctac
tacaagctctccctgctcgagcaggtcccggcgctcaaccgcgcgatccgccacaacatg
cgcgacaccttcggcatgcaggtcccggacgtgccggtggtgcggcccggctcgtggatc
ggcggcgaccacgacggtaacccctacgtcaacgcgcgcacgctgacgtacgccacccgc
aacgccgctaagaccgtgctgcgtttctacgaggagcagctcggcgagctggaacgcgag
ctgtcgctctcggaccgctactcctcctgctccaaggagctcctggcgctggccgacgcc
gcccacaacgactgggagtcccgcgtcgacgagccctaccgccgggccatctacggcatc
cgcaaccgcgtgcgcgccaaccttcacgagatcggcgacaagaaggtcgcccaggtcgac
gccgccgcctacgcctcgccggaggagttcaagcgcgacctcgacaccatcgaccgctcg
ctgcgccagttcaacgacgacgtcatcgccgacgaccggctggcccgcatccgctcggcg
gtgaccaccttcggcttccacctctacacgctcgacctgcgccagaactccgagtccttc
gagaacgtgcttaccgaggtcttcgccgcagctggtcgctcggacgactaccgcgcgctc
ggcgaggaggagaagatcgcgctgctcgtcgaggagctcaagaccccgcgcccgctgctg
ttcccggatgccgcgcccatgagcgaggtcaccgagaaggagctgggcatcttccgcgcc
gcggcccaggctgtgcgcaacttcggcccgcagtcggtctcgcactgcatcatctccatg
accggcaccgtctcggacatcctcgagccgatggtgctgctcaaggaggtcggcctgcgc
gaggtggacgtggtcccgctgttcgagaccatcgacgacctcaaggccggcgccgggatc
ctggagaagctgtggtcggtgcccttctaccgcgagcacctgcgcgcccgcggcgacgtg
caggaggtcatgctcggctactcggactccaacaaggacggcggctacctccaggccaac
tgggcgctctacgacgccgagctggccctcgtcgagctgtgcaacgcccacggcatcgag
ctgcgcctggcacacggtcgcggcggcgccgtcggtcgcggcggcggaccgacctacgac
gccatcctcgcccagcccaagggcgcggtgtccggctccgtgcgcatcaccgagcagggc
gaggtcatctccgccaagtacggcgcacccgaaaccgcccgccgccacctggaggccttc
gtctccggcgcgctggtggcgtcgctcaccgacaccgagccgatcgccgacccggaccgc
gcctacgccatcatgcgcgagctgtccgacctgtcggggcagaagtaccaggagctcgtc
ggcgacccgggcttcatcgaatacttcacccagtccaccccgctgcacgagatcggtgac
ctcaacctgggctcgcgcccggccgcccgcaagcagaccaccgccatctccgacctgcgc
gccatcccgtgggtgctgtcctggtcgcagtcgcgcaccaacgtccccggctggttcggc
gtgggcagcgccgtgacccgctgggcgggcgaggacgcctcccgctgggaggagctgcgc
gccctgcaccgcgactggccgttcttccgctcggtcatgtccaacatggctcaggtcatg
gccaaggccgagatctcgctggcccgcctctacgccaacctggtcgacgacaagcagatc
gccgaccgcatctacaccctcatcgccgaggagttcgagctgaccaagaaggtctacctc
gaggtcaccggcaacaaggacctcaccgcggagaaccagcgccaggcccgctcgctcaag
cgccgctacccgtaccttctgccgctcaacgccatccagctggagctgctgcgccgctac
cgcgctggcgacgactccttcctcgtgtccaagacgattcaggttacaatgaacggtctt
gccaccgcgctgcgtaacgcgggctag

DBGET integrated database retrieval system