KEGG   Cyanothece sp. PCC 7424: PCC7424_0648Help
Entry
PCC7424_0648      CDS       T00808                                 

Definition
magnesium chelatase ATPase I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cyc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
714726..715799
Genome map
AA seq 357 aa AA seqDB search
MTATLQAPPKTRRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIEVVANDPFNSHPCDPDLMSDQVRQQVEEQIPLSIAHKKVTMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDQDP
LKFCEKYQAEQDNLQQQLVNAQNLLPQVNIDYDLRVKISEVCSELDVDGLRGDIVTNRAA
KALTAFEGRTEVTVDDIKRVITLCLRHRLRKDPLESIDSGYKVQKAFGRVFGVDIDA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacactccaagcccctcctaaaactcgccgagtcgtctttccttttactgct
attgttggccaagaagagatgaaattggccttacttctcaacgtgatcgatcctaaaatt
gggggtgtgatgatcatgggcgatcgcggtacggggaaatctacgactatccgcgcttta
gctgatttattaccagaaattgaggtcgtcgctaacgatccctttaattctcatccctgt
gatcccgatctcatgagtgatcaagtcagacaacaggtagaagaacagatccccctctcg
atcgcccataaaaaagtgactatggtagacttacctttaggcgcaacagaagaccgagtt
tgtggcacgatcgatattgaaaaagccctttcagaaggggttaaagcgtttgaaccggga
ctactggcgaaagctaaccgaggaattttatatgtagatgaggtaaatttacttgacgat
cacctagttgatgtgctactggactctgctgctagtggatggaatacggtagaacgggaa
gggatttctattcgtcacccggcccggtttgtattggtcggatcgggaaacccagaggaa
ggagaattacgccctcaattattagaccgtttcggaatgcacgcggaaattcacacggtg
aaagagcctcctttacgggttaaaattgtagagcaacgggcagaatttgaccaagatcct
ttaaagttttgtgagaaatatcaagctgaacaagataatttacagcaacaattagttaat
gctcaaaacttgttacctcaagtgaatattgattatgatttacgggtcaaaatttctgag
gtttgttcagaattagatgttgatgggttacggggtgatattgttaccaatagggcggct
aaagcgttaacggcttttgaaggacggacagaggtaacggttgatgatattaaacgggtt
attactctgtgtctgcgtcaccgactccgtaaagatcctttagaatcgatcgattctggt
tataaagttcaaaaagcttttggccgggtttttggggtagatatagatgcttaa

DBGET integrated database retrieval system