KEGG   Cycloclasticus sp. P1: Q91_2096Help
Entry
Q91_2096          CDS       T02265                                 

Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Q91_2096
Enzymes [BR:cyq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Q91_2096
Exosome [BR:cyq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q91_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2197287..2198252)
Genome map
AA seq 321 aa AA seqDB search
MRSSQFSRRLMRETVLTTDDLIYPVFVIEGESQRQTIDSMPGVERLSIDLLVDEARELVT
LGVPAIALFPVTPASVKTSSAEEAWNPQGLAQRAVRALKAALPELGVITDVALDPFTTHG
QDGLIDDTGYVLNDDTVEVLVKQALSHAEAGADVVAPSDMMDGRVGAIREALEVEGYTNT
KILAYSAKYASSFYGPFRDAVGSAAQLGAGNKYSYQMDCANTDEALIEVGLDIEEGADMV
MVKPGMPYLDIVRRVAESFDTPVFAYQVSGEYAMIKAAVQNAWLEERAVVLESLLAFKRA
GAQGVLTYFAKDVARWLTEEK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcaagccagtttagtcgccgtttaatgcgtgaaacagtgttaacaacggatgat
ctgatttaccccgtatttgtgattgagggcgagagccaacgtcaaacaatcgattctatg
ccgggtgttgagcgacttagtattgatttgttggtggacgaagcgcgtgaactcgtgaca
ctaggggtgcctgcgattgccttatttcctgtgacgcccgcgagtgttaaaacaagttca
gcagaggaagcgtggaacccgcaaggtttggcgcaaagagcagttcgggcgttaaaggct
gcattgccggagctaggtgttattaccgatgtcgccttagacccttttacaactcatggt
caggatgggttgattgacgatactggttatgtgttaaacgatgacacggtggaggtgttg
gtaaaacaagccttgtcccatgcagaagcgggggctgatgtggtggcaccctctgatatg
atggatggccgtgtgggtgcaatccgcgaagcactggaggtagagggctatacgaatact
aaaattttggcctattcggcgaaatatgcatccagtttttatggcccgtttagggatgca
gtgggttcagcggctcagttaggagcaggcaataagtacagttatcaaatggactgtgca
aataccgatgaggcattgattgaagtcggcttagatattgaagaaggtgctgacatggta
atggtcaagccaggcatgccctacctagatattgttcgtcgggtggctgaatcgtttgac
acccccgtatttgcttatcaggtgagtggggagtacgcaatgataaaggcagcggtacaa
aatgcttggcttgaggagcgagctgttgttttagagtctttactggcatttaaacgggca
ggtgcgcagggtgttttaacttactttgcaaaagatgtggcacgctggctaacggaagaa
aaataa

DBGET integrated database retrieval system