KEGG   Desulfosporosinus acidiphilus: Desaci_0022Help
Entry
Desaci_0022       CDS       T02148                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dai00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desaci_0022
DNA repair and recombination proteins [BR:dai03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Desaci_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18037..18633
Genome map
AA seq 198 aa AA seqDB search
MDFLNYPQPLADLISCLARLPGIGPKTAGRLAFYLLQQPRISEDLAQAIHAANHSIRKCS
ICCNFTDQDPCVLCQNPQRDSSELCVVEHPRDVVSLEKTKEFKGRYHVLHGVLSPMEGIG
PEQLTISLLLKRLEGVKEVVMALNPTVEGEATALYLARLLKPLGIKVTRIAHGLPVGGDL
EYADEVTIARALEGRRQL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggattttctaaattaccctcagcctttggcagatcttatcagttgtcttgcacgcctt
ccgggaattggtccaaagacagcgggtcgattggcattttatcttcttcagcagccccgg
atttccgaagatttggcacaggctattcacgccgcgaatcattctataagaaaatgttcg
atttgttgtaactttactgatcaagatccatgtgtactctgtcagaacccccaaagagac
tcctcggaactttgtgttgtcgaacatcccagggacgtcgtatccttagaaaagactaaa
gaatttaaagggcggtatcatgttttacatggtgtgctctccccaatggagggtatagga
ccggagcaattaaccattagccttcttttgaagcgtttagagggcgttaaggaagtggtt
atggctctaaatcccacggtggaaggagaagctacggccttatatttagcccgtctgtta
aaacctttaggaattaaagtgacccggattgctcatggattacccgtgggcggtgatctg
gaatatgccgatgaagtgactattgctcgagcgttagaaggacggcgtcaactctaa

DBGET integrated database retrieval system