KEGG   Desulfosporosinus acidiphilus: Desaci_0022Help
Entry
Desaci_0022       CDS       T02148                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dai03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18037..18633
Genome map
AA seq 198 aa AA seqDB search
MDFLNYPQPLADLISCLARLPGIGPKTAGRLAFYLLQQPRISEDLAQAIHAANHSIRKCS
ICCNFTDQDPCVLCQNPQRDSSELCVVEHPRDVVSLEKTKEFKGRYHVLHGVLSPMEGIG
PEQLTISLLLKRLEGVKEVVMALNPTVEGEATALYLARLLKPLGIKVTRIAHGLPVGGDL
EYADEVTIARALEGRRQL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggattttctaaattaccctcagcctttggcagatcttatcagttgtcttgcacgcctt
ccgggaattggtccaaagacagcgggtcgattggcattttatcttcttcagcagccccgg
atttccgaagatttggcacaggctattcacgccgcgaatcattctataagaaaatgttcg
atttgttgtaactttactgatcaagatccatgtgtactctgtcagaacccccaaagagac
tcctcggaactttgtgttgtcgaacatcccagggacgtcgtatccttagaaaagactaaa
gaatttaaagggcggtatcatgttttacatggtgtgctctccccaatggagggtatagga
ccggagcaattaaccattagccttcttttgaagcgtttagagggcgttaaggaagtggtt
atggctctaaatcccacggtggaaggagaagctacggccttatatttagcccgtctgtta
aaacctttaggaattaaagtgacccggattgctcatggattacccgtgggcggtgatctg
gaatatgccgatgaagtgactattgctcgagcgttagaaggacggcgtcaactctaa

DBGET integrated database retrieval system