KEGG   Desulfurivibrio alkaliphilus: DaAHT2_0984Help
Entry
DaAHT2_0984       CDS       T01244                                 

Definition
6-phosphogluconolactonase
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:dak01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dak00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1180156..1180878
Genome map
AA seq 240 aa AA seqDB search
MEIKKFANTDQMAQAAAELVLTSALAAVIERGVFSLVLAGGGTPLPLYRRLAAPPFLAQM
PWELTHLFQGDERCLPPEHPDSNFGRAAATLLAPGQVPADNIHRMTGEDPDPKRAAAAYQ
RQIEDFCRDFAVNSFDLVLLGMGSDGHIASLFPGSALLAEQDRLVAAETEPAGNPPVPRL
TLTLPAINSARRVLLLTSGPEKEKIMNEIIADRQAAAARYPAARVMPSQEFYWLRTISDE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaaatttgccaataccgaccagatggcccaggctgccgccgaattggtg
ctgaccagcgccctggcggcggtgatcgagcggggggttttctctctggtgctggccggc
ggcggcacccctctgcccctgtaccggcgcctggccgccccgcccttcctggcgcaaatg
ccctgggagttaacccatcttttccagggcgacgaacgctgcctgccgccggagcacccg
gacagcaacttcggccgcgccgccgccaccctgctggcccccggccaggtgccggcggac
aatatccaccgcatgaccggcgaggacccggatcccaaacgagctgccgccgcctaccag
cgccagattgaagatttttgtcgcgattttgcggtgaacagtttcgatcttgtcctgctg
ggcatgggcagcgatggccatatcgcctcgctgtttcccggctcggcgctactggcggaa
caagaccggctggtggcggcggagaccgagcctgcaggcaacccgcccgtaccccgcctt
accctgaccctgcccgccatcaacagtgcccgccgggtgctgctgctgaccagcggcccg
gaaaaggaaaaaatcatgaacgaaattatcgccgaccggcaggcggcggccgccagatac
cccgctgcccgggtaatgccaagccaggagttttactggctgaggacaattagtgatgag
tga

DBGET integrated database retrieval system