KEGG   Desulfobacca acetoxidans DSM 11109: Desac_1416Help
Entry
Desac_1416        CDS       T01454                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dao  Desulfobacca acetoxidans DSM 11109
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dao01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:dao00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1632386..1633687
Genome map
AA seq 433 aa AA seqDB search
MITLALESIRNLSPERRQAIMKRSSLDVTAVLDDIKKIVQEVRQHGDRIALDFHRQYKDD
ISSADLVASEAEIRAAYESIDPKLLDALKLAAANIEKFHRAQLDRGMWAIEVQPGILAGR
LQRPLDRVGCYIPGGLAKYPSTVLMTIIPARVAGVSEIIACTPPDQGMTANPTTLAAAHL
AGATNIYKIGGPWAVASMAYGTETVPQVDKIVGPGNKYVTAAKLLVFGEVGIDSPAGPSE
ALILADESAEARLVAIDFLSQAEHDPDAAAVLVTTWEPLAHRVIDLIKEEFHNLPRQEIL
KSAINHHSAVLLAHDLDEAIDFVNHYAPEHLQIITREPFAVLPRIRHAGSIFLGMYAPVP
VGDYASGTNHVLPTGRTARMFSGLSVDDFIKKPTFQHLTKEGLKSLKDAVVRLAEAEGLP
IHARAVAERFRYV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgattacacttgcccttgaaagcatccgcaacctttccccggagcggcgccaggctatc
atgaaacgttccagcctggatgtaactgcggttttggatgacatcaaaaagattgtccaa
gaggtgcggcagcatggcgaccgcatcgcgctcgattttcatcggcagtataaagacgac
atcagttcggcagatttagtagccagcgaagcggagattcgtgcagcatacgaatcaatc
gatccaaagttgcttgatgccctgaagctggcagcggcgaatatcgaaaaatttcatcgg
gcccaattagatcgggggatgtgggccatcgaggtgcagccgggcatcctggctgggcgg
ttgcagcgcccgttggatcgggtcggctgttatattcccggtggcctggccaaatatccc
tctacggtgctcatgactatcatcccggcgcgggtggccggggtgtcggagatcattgcc
tgtaccccgccggaccagggcatgacggccaaccctactactttggcggcggctcatctg
gccggcgccacaaacatttacaagataggtggtccttgggcggtagcctctatggcgtat
ggcaccgagaccgtgccgcaggtggataagatcgtcgggccgggaaataaatatgttact
gcggccaaactgttggtcttcggagaggtaggcatcgactctcctgccggtccgagtgaa
gccctcattttggctgatgaatccgcagaagccagattggtggcgattgatttcctttcc
caagcggagcatgatccggatgccgccgcagtgttggtaaccacatgggagcccctggca
catcgggtcattgacctcatcaaagaggaattccataatctgccccggcaggaaatcctt
aaatctgccatcaaccatcattccgcggtgctgttggctcatgatttggatgaggcgatt
gattttgtgaaccattacgccccggagcacctgcagattatcacccgggagccttttgcc
gtcctgccgcgcatacgccatgccggttccatctttctcgggatgtatgccccggttccg
gtgggtgattatgcctccggaactaatcatgtcttgccgacggggcggacggccaggatg
ttttccggattgtcagtagatgattttataaagaagccaaccttccagcatttaaccaag
gaaggcttgaaatcgctcaaagatgcggtcgtgcggttggccgaggccgaaggccttcct
atacatgcccgggcggtagccgagagattccgttatgtttag

DBGET integrated database retrieval system