KEGG   Desulfomicrobium baculatum: Dbac_0254Help
Entry
Dbac_0254         CDS       T00963                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dba  Desulfomicrobium baculatum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dbac_0254
Enzymes [BR:dba01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Dbac_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
299816..300697
Genome map
AA seq 293 aa AA seqDB search
MNPVRLDTVSWDVSRGRTLGPAPFFVVGILNVTPDSFYDGGHAADVDAAVAKGLALLEEG
ADILDIGGESTRPFSEPVPADMELARVLPVVRGILAVRPDAVLSVDTTKASVARACLEAG
ALILNDVSAMDVDPELLQVVRDFHPGYVLMHSLGRPRTMQVEPRYEDVMAEIMRFFEAKL
EILVRSGVSESRIALDPGIGFGKTVEHNLEILKNICKLFKFGRPVYMALSNKSLWGELLG
RQGRERNAATLAATVALFEKGVRIHRVHEVREIRDGLTVAHMLGKGTSGEQGC
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaacccggtgagattggatacggtctcctgggatgtgagcagggggaggactttgggt
cctgcccccttttttgttgtgggcatcctgaacgtgacgcccgattctttttatgatggc
ggacacgccgccgatgtcgacgcagccgtggccaaagggcttgcgctcttggaggagggg
gcggacatcctcgatatcggcggggaaagcacccgccctttttccgagcccgtacccgca
gacatggaactggcgcgggtattgccggttgtgcgggggatcctcgcggtcaggccggat
gccgtcctgtcggtggacacaaccaaggcctccgtggccagagcctgcctggaagccgga
gccctgatcctcaatgacgtctcggccatggatgtcgacccggaactcctgcaggttgtg
cgcgattttcatcccggctacgtcctcatgcacagcctcggtcgcccgcggaccatgcag
gttgagccccggtacgaggacgtgatggctgaaatcatgcgctttttcgaagcgaagctt
gaaattctggtgcgttcgggggtgtccgagtcccggattgctcttgatcccggcatcgga
tttggcaagactgttgaacataatcttgaaatattgaaaaatatctgtaaattattcaaa
ttcggcaggcccgtgtacatggcgctttccaataaatccctatggggagagctgctcggc
cgccaggggcgggaacgcaacgcggccacgctggccgcgaccgtcgccctttttgagaag
ggtgtgcgtatccaccgggtgcacgaggtgcgcgaaattcgtgacggcctgaccgtcgca
cacatgcttgggaagggaacttcgggggaacaggggtgctga

DBGET integrated database retrieval system