KEGG   Dickeya dadantii Ech586: Dd586_1600Help
Entry
Dd586_1600        CDS       T01138                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ddc  Dickeya dadantii Ech586
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ddc00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ddc00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1800561..1801586
Genome map
AA seq 341 aa AA seqDB search
MGPLMLDVAGYELDAEDREVLAHPLVGGVILFSRNFHDADQLTELVRQMRRASRERLVVA
VDQEGGRVQRFRHGFTPLPAAQSFAALNSLEQAQQLAQEAGWVMAAEMITLDIDISFAPV
LDVGHQSAAIGDRAFHDDPDTLLAVAEHFIAGMRAAGMKATGKHFPGHGAVTADSHKETP
QDNRPMAQIRERDMRVFRELIARQQLDAIMPAHVIYRDADPRPASGSPYWLKQVLRQELG
FGGIIFSDDLSMEGAAVMGGYAERAQAALDAGCDMILVCNQRQGAISVLDNLSAVKVPGL
ETLYHRGMITRRELLNSSRWKQATSQLTALSERWQAHKAAG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccgttaatgttagatgtggccggctatgagctggacgcggaagatcgtgaagtg
ctggcacacccgctggtagggggcgttatcctgttcagccgcaattttcacgatgctgac
caattgaccgagttggttcgtcagatgcgacgtgcctcgcgtgagcggttggtggtggcc
gtcgatcaggaaggtggccgggtacaacgctttcgtcacggctttaccccattaccggcc
gctcagtcgtttgccgcattgaattcgttggaacaggctcagcaactggcacaagaagcg
ggctgggttatggcggcggaaatgatcacgctggacattgatatcagctttgcaccggtg
ctggatgtggggcatcagagtgcggcaatcggtgatcgtgctttccacgacgacccggat
accttgctagccgtcgcagagcattttatcgcgggtatgcgtgccgccggtatgaaagcg
acaggtaagcacttccccggacacggtgcggtcacggcggattcccacaaggaaaccccg
caggataaccggccgatggcgcaaattcgggaacgggatatgcgtgtctttcgggagttg
attgcccgacagcagttggatgccatcatgcctgcgcatgttatctaccgtgatgccgat
cctcgcccggccagcgggtcgccgtactggctgaaacaggtgttgcgtcaggaattgggg
ttcggcggcattattttctcggatgacctgtcgatggagggggcggcggtgatgggcggc
tacgctgagcgcgcacaggcggcgttggacgctggctgcgacatgattttggtctgcaat
cagcgccagggagccatcagcgtattggataatctgtctgcggtcaaagtaccggggctg
gagacgctctatcatcggggaatgatcacgcgtcgggaactgctgaattcatcgcgctgg
aagcaggcgacgtcgcagttgacggcattgagtgaacgctggcaggcacataaagccgct
ggctaa

DBGET integrated database retrieval system