KEGG   Dickeya dadantii Ech586: Dd586_1600Help
Entry
Dd586_1600        CDS       T01138                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dd586_1600
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Dd586_1600
Enzymes [BR:ddc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dd586_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1800561..1801586
Genome map
AA seq 341 aa AA seqDB search
MGPLMLDVAGYELDAEDREVLAHPLVGGVILFSRNFHDADQLTELVRQMRRASRERLVVA
VDQEGGRVQRFRHGFTPLPAAQSFAALNSLEQAQQLAQEAGWVMAAEMITLDIDISFAPV
LDVGHQSAAIGDRAFHDDPDTLLAVAEHFIAGMRAAGMKATGKHFPGHGAVTADSHKETP
QDNRPMAQIRERDMRVFRELIARQQLDAIMPAHVIYRDADPRPASGSPYWLKQVLRQELG
FGGIIFSDDLSMEGAAVMGGYAERAQAALDAGCDMILVCNQRQGAISVLDNLSAVKVPGL
ETLYHRGMITRRELLNSSRWKQATSQLTALSERWQAHKAAG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccgttaatgttagatgtggccggctatgagctggacgcggaagatcgtgaagtg
ctggcacacccgctggtagggggcgttatcctgttcagccgcaattttcacgatgctgac
caattgaccgagttggttcgtcagatgcgacgtgcctcgcgtgagcggttggtggtggcc
gtcgatcaggaaggtggccgggtacaacgctttcgtcacggctttaccccattaccggcc
gctcagtcgtttgccgcattgaattcgttggaacaggctcagcaactggcacaagaagcg
ggctgggttatggcggcggaaatgatcacgctggacattgatatcagctttgcaccggtg
ctggatgtggggcatcagagtgcggcaatcggtgatcgtgctttccacgacgacccggat
accttgctagccgtcgcagagcattttatcgcgggtatgcgtgccgccggtatgaaagcg
acaggtaagcacttccccggacacggtgcggtcacggcggattcccacaaggaaaccccg
caggataaccggccgatggcgcaaattcgggaacgggatatgcgtgtctttcgggagttg
attgcccgacagcagttggatgccatcatgcctgcgcatgttatctaccgtgatgccgat
cctcgcccggccagcgggtcgccgtactggctgaaacaggtgttgcgtcaggaattgggg
ttcggcggcattattttctcggatgacctgtcgatggagggggcggcggtgatgggcggc
tacgctgagcgcgcacaggcggcgttggacgctggctgcgacatgattttggtctgcaat
cagcgccagggagccatcagcgtattggataatctgtctgcggtcaaagtaccggggctg
gagacgctctatcatcggggaatgatcacgcgtcgggaactgctgaattcatcgcgctgg
aagcaggcgacgtcgcagttgacggcattgagtgaacgctggcaggcacataaagccgct
ggctaa

DBGET integrated database retrieval system