KEGG   Desulfovibrio alaskensis: Dde_3534Help
Entry
Dde_3534          CDS       T00294                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dde  Desulfovibrio alaskensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dde_3534
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dde_3534
  Lipid metabolism
   00071 Fatty acid degradation
    Dde_3534
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dde_3534
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dde_3534
   00626 Naphthalene degradation
    Dde_3534
Enzymes [BR:dde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dde_3534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3491618..3492760
Genome map
AA seq 380 aa AA seqDB search
MSVTKFAIPEVIFGNSSLRYLAQCALRLGARRIFLVSDPGLEKAGWVQHVIDILSEDRLE
CVYYNDVDSNPRDWQVHEGARLYTEERADLIIGLGGGSPIDAAKGIATIASNGGRIHDYE
GANRIMRPLPPMIFIPTTAGSGSDISQYCIITDVERQLKMSIISRSLVPNVSIIDPSLLL
TKTVELILASAIDALAHAVESYVSRLASPFTETQALYAIRLIMENLETAARTRNPAALEK
LSIASTAAGMSFSNAGLGIGHALAHSLGGRYDVLHGLVHPVLLPHVMRYNLPVCREKMDN
IAAVVLQSCDTAGTGRALEGIEQLEHMFRSLQVTTRLRDILPDDSQLEQICKMAVPDECA
LTNPREATWADLMGICKEAW
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtaacgaagttcgctattccggaagtcatcttcggcaactccagcctgcggtat
cttgcacagtgtgcgctgcggctcggagcaagacggatatttctggtaagtgatcccggg
ctggaaaaggcgggctgggtgcagcacgtcattgacattctttccgaagaccggctggaa
tgcgtctattacaacgatgtggattccaacccccgagactggcaggtgcacgagggcgcc
cgtctgtacactgaagaacgcgccgatctcatcatcggtctcggcggcggcagccccatt
gacgccgccaagggcattgccaccattgccagcaacggcgggcggattcatgattacgag
ggcgccaaccgcatcatgcgtcccctgccgcccatgattttcatccccaccacggcgggc
agcggctctgacatttcacagtactgtattatcaccgacgtggagcggcagctcaaaatg
tccatcatcagccgctcgctggtgcccaacgtctccatcatagacccttctcttctgctc
acaaaaaccgtggaactgattcttgcttcggccatagacgcactggcccacgcggttgaa
tcctatgtatcacggctggcttctccgtttacggagacgcaggcgctgtatgccatccgg
ctgatcatggaaaatctggaaacggcagcccgcacgcgcaaccccgcggcactggaaaag
ctgagcatcgccagtaccgcggcgggcatgtctttcagcaatgccgggctgggcatagga
catgcgctggcgcactcgctgggcggacgctacgacgtgctgcacgggctggtgcatccg
gtactgctgccgcacgtcatgcggtacaacctgcctgtgtgccgcgaaaaaatggacaac
atcgccgccgtggtgctgcaaagctgcgacaccgccggaaccggccgcgcactggagggc
atagaacagctggaacacatgttccgttcgctgcaggtcaccaccagactgcgtgatatt
ctgcccgacgacagtcagctggagcagatatgcaaaatggcggtgccggacgaatgcgca
cttaccaacccgcgcgaagccacctgggctgacctgatggggatatgcaaagaggcctgg
taa

DBGET integrated database retrieval system