KEGG   Deferribacter desulfuricans SSM1: DEFDS_2060Help
Entry
DEFDS_2060        CDS       T01188                                 

Gene name
cbiK
Definition
sirohydrochlorin cobaltochelatase (EC:4.99.1.3)
Orthology
K02190  
sirohydrochlorin cobaltochelatase [EC:4.99.1.3]
Organism
ddf  Deferribacter desulfuricans SSM1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ddf00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2090751..2091725)
Genome map
AA seq 324 aa AA seqDB search
MKKVIIFLFVAVFLMTGVCMAKMEKNKTKKNAIVIASFGTTYPSGLKSIINIINMVKNEF
PNTEVRVTFTSNIIRKIWQKRNKHPEEWIKKGVPKEILNVKGVVATLGDLSDEGYKNIVI
QPTHIYHGEEFSDLLEYARGLNSIQTIKKRWKPFHKIVLGRPALGTYGDKYDYHEDIKEV
VKALRNDVELARKHNAALVYMGHGNEFYSTGAYIETEKEFNRQYKDVKIFIGTVEGYPSL
GDVILKLKKQNIKKVVLKPFMVVAGDHASNDMAGDEPDSWKNILKKEGIEVIPVIEGLGS
NNSFAKIFLEHLKDAAKDGGINLK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttattatttttctttttgttgcagtattcttaatgacaggagtttgtatg
gctaaaatggaaaagaacaaaacaaaaaaaaacgcaattgtaattgcaagctttgggact
acttacccttcaggactaaaatctattattaatattatcaatatggttaaaaatgaattc
cctaataccgaagttagagtaacttttacttcaaatattataagaaaaatatggcaaaaa
agaaataaacaccctgaagagtggataaaaaaaggtgtgccaaaagagattttaaatgtg
aaaggggttgttgctacattaggtgatttgtctgacgaagggtataaaaacattgttatc
cagccaacacatatctaccatggtgaagagttctctgaccttttagaatatgcaagaggc
ctaaactctattcagacaattaaaaaaagatggaagccttttcacaaaatagtgcttggt
cgtccagcacttggaacttatggtgataaatacgattaccatgaagatataaaagaggta
gtaaaagcattaagaaatgatgttgagttagcaagaaagcataatgcagcattagtctat
atggggcatggaaatgaattttattccacaggtgcatatattgaaacagaaaaagagttc
aaccgtcaatataaggatgtaaaaatttttataggtacagttgaaggttatcctagtttg
ggagatgtgattttaaaattaaaaaagcaaaatatcaaaaaagtggttttaaaaccgttt
atggttgtagctggggatcatgcaagtaacgatatggcaggggatgaacctgattcttgg
aaaaatattttgaaaaaagaagggatagaagttatccctgtaattgaaggacttggttct
aacaacagttttgcaaagatttttttagagcatttaaaagacgctgctaaggatggtggg
attaatcttaaatga

DBGET integrated database retrieval system