KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285311Help
Entry
DDB_G0285311      CDS       T00245                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00010  Glycolysis / Gluconeogenesis
ddi00260  Glycine, serine and threonine metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01130  Biosynthesis of antibiotics
ddi01200  Carbon metabolism
ddi01230  Biosynthesis of amino acids
Module
ddi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ddi_M00002  Glycolysis, core module involving three-carbon compounds
ddi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDB_G0285311 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DDB_G0285311 (gpmA)
Enzymes [BR:ddi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DDB_G0285311 (gpmA)
Membrane trafficking [BR:ddi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    DDB_G0285311 (gpmA)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DDB_G0285311 (gpmA)
  Exosomal proteins of melanoma cells
   DDB_G0285311 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 8625042
NCBI-ProteinID: XP_638289
dictyBase: DDB_G0285311
UniProt: Q54NE6
Position
4
AA seq 249 aa AA seqDB search
MVYKLVLIRHGESTWNKENKFTGWTDVDLSEKGVQEAHEAGKRLLKAGFTFDIAYTSVLK
RAIRTLWILLEELNLYWIPVSRQWRLNERMYGSLQGLNKSETAAKYGEDQVLIWRRSYDI
PPPALEESDERYPGNDPRYAKLDKSDLPKTECLKDTVERFLPLWNDTIAPTIKSGQKVLI
AAHGNSIRALVKYLDNIADDKIVSMDIPTGIPLVYELDENLKPIKHYYLADESELNAAIQ
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggtttataaattagttttaattagacatggtgaatcaacatggaataaagagaataaa
ttcacaggttggacagatgttgatctttcagagaaaggtgttcaagaagctcatgaagca
ggtaaaagattattaaaagcaggttttacatttgatattgcctacacaagtgttttaaag
agagcaattcgtaccctttggatcctcttagaagaattgaacctttattggattccagtt
tcaagacaatggagattaaatgaacgtatgtatggttcacttcaaggtttaaataaatca
gaaactgccgcaaaatatggtgaagatcaagtattaatctggagaagatcttatgatatc
ccaccaccagccctcgaagaatctgatgaacgttatccaggtaatgatccacgttatgct
aaattagataaatctgatctcccaaaaactgaatgtcttaaagatactgttgaaagattt
ttaccactttggaatgatactattgctccaacaattaaatcaggtcaaaaagttttaatt
gctgctcatggtaattcaattagagctttagttaaatatttagataacattgctgatgat
aagattgtatcaatggatattccaactggtatcccattagtatatgaattggatgaaaac
cttaaaccaattaaacactactaccttgctgatgaatcagaattaaatgctgctatccaa
gctgttgccaatcaaggtaaagctaaataa

DBGET integrated database retrieval system