KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292736Help
Entry
DDB_G0292736      CDS       T00245                                 

Gene name
plc
Definition
phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DDB_G0292736 (plc)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    DDB_G0292736 (plc)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     DDB_G0292736 (plc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
DictyBase: 
UniProt: 
Position
6
AA seq 801 aa AA seqDB search
MDTLTNSQDYSNVDLSLESLAEELYNIQSFNKDVILDSFDIDDYDHTQLDTTIDFNKFKI
GLTILKISSKGKPQKKKLIFDLARNQIVCGKKKKVNFSEIDEIRVGHKTNIFNQFKSSKN
LKEDIESIQQSFSILFSGNLRKTMDFVCSDIPERRQIVSALYHVVQESKSVNNEYNFVKR
EWDRVGKDSIDFSTLKKILARLNFTTSDAVLHNLMKFSDSNSDYHLDFSEFSNLLKLLRS
HPEMKPVFYKYNGGNGEWVPIQGMIDFFRIEQSEVWTVEQCRDLIKKYHHERLDCISFEN
FEEFICGEANLAQYPHTSTVYQDTSKPLSYYFINSSHNTYLSGHQLKGLSTSEMYTNTLR
QGCKCVELDVWDGNDGDPIIFHGNTLTSQIKFSHVCETIKARGFETSPYPVILSLEVHCS
VPQQIMMANHMKEIFGEMLPTPLPEGTKELPTLDSLKYKILLKGHTSHTHVSAVGNSSAS
SSQSNIQTDDNDDDGAVDLTEYDEVDDRSASSSSSSFSLSFGSSGKKKKITKIKIAPEFE
ELIYLVSHGFKSGNTTKEIPSYKIHSLVEEKVKQLVQSEPREVVEASQNHLLRVYPRGTR
FDSSNFDPMPGWSIGCQLAALNQQTSSEPMWINDGMFSDNGGCGYVLKPPCLLPGECETY
DPTSPERIKSSKYSRLIVNVISARQLPKYTKSTKGEVIDPYVTLSIVGTHFDQKVEKTKV
IDNNGFNPHWGEEFEFPLYNSQLSMLLIRVDDKDKVGHNRIGHHCIRVENIRPGYRILKL
KNNFNRTIPLANLLCKFTFVE
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggatactttaacaaattcccaagattattcaaatgtcgatttatcattagaatcatta
gcagaagaattatataatattcaatcatttaataaagatgtaattttagatagttttgat
attgatgattatgatcatactcaattagatacaacaattgattttaataaatttaaaatt
ggattaacaattttaaagatttcatcaaaaggtaaaccacaaaaaaagaaattaatattt
gatttagcaagaaatcaaattgtatgtggtaaaaagaaaaaagtgaatttctcagagatt
gatgagattagggttggtcacaagaccaacattttcaatcaatttaaatcatcaaagaat
ttaaaagaggatatcgaatcgattcaacaatcattttcaattctattcagtggtaatctt
agaaagacaatggatttcgtttgtagtgatattccagaacgtagacaaatagtgtcggca
ttgtatcatgtggttcaagaatcaaagagtgtcaataacgaatacaatttcgttaagcgt
gaatgggatagagttggcaaagattccatcgatttctcgacattgaagaagatattggcc
agactcaacttcaccacctctgacgccgttctccacaatcttatgaaattcagcgattcc
aatagcgactaccatttggacttttctgaattttccaatcttcttaaactactccgtagt
catccagagatgaaacctgtattctataaatataatggtggcaatggtgaatgggtgcca
attcaaggtatgattgatttctttagaattgagcaatctgaagtgtggactgttgaacag
tgtagagatttaattaaaaagtatcatcacgagagattggattgtatttcatttgaaaat
ttcgaggagtttatttgtggtgaagcaaacttggcacaatacccacacacaagtactgtc
tatcaagatacttccaaaccgttgtcctactatttcataaattcatcccataacacctac
ctttcaggccaccaattgaaaggtctttccaccagtgaaatgtatacaaatacactcaga
cagggttgcaaatgcgttgaattggacgtttgggatggtaatgatggtgatccaatcatt
ttccatggtaatacattaacaagtcaaattaaattctctcatgtttgtgaaaccattaaa
gctagaggatttgaaacttcaccatatcctgtcatactcagtttagaagttcattgttca
gtacctcaacaaatcatgatggcaaatcatatgaaagaaatttttggtgaaatgttacca
actccattaccagagggtacaaaagaattaccaacattagactcattaaaatataaaatt
ttattgaaaggtcatacttctcatactcatgtgagtgctgttggtaattcatcagcatca
tcatctcaatcaaatattcaaactgatgacaatgatgatgatggtgctgttgatttaaca
gaatatgatgaagttgatgatagaagtgcatcatcatcatcctcatcattctctttatca
tttggtagtagtggtaaaaagaagaaaattacaaaaattaaaattgcaccagaatttgaa
gaattaatttatttagtttcacatggatttaaatctggtaatactacaaaagaaattcca
tcatataaaattcattcattggttgaggagaaagttaaacaattggtacaatctgaacca
agagaggtcgttgaagcatcacaaaatcatttacttagagtttatccaagaggtactcgt
ttcgatagtagcaattttgatccaatgccaggttggagtattggttgtcaattggcagct
ttgaatcaacaaacttcatcggaaccaatgtggatcaatgatggtatgttctcagataat
ggtggttgtggctacgttttaaaaccaccttgtcttttaccaggtgaatgtgaaacttat
gaccctacctcaccagagagaatcaagtcaagtaaatactcaagactcatagtaaatgta
attagtgcaagacaattaccaaagtatactaaatcaactaaaggtgaagtcattgatcct
tatgttaccctatcaatcgttggcactcatttcgatcaaaaagttgaaaaaactaaagtt
atcgacaataatggtttcaatccacattggggtgaagaatttgaattcccactttacaat
tctcaattatcaatgttattaattcgtgttgatgataaagataaagttggtcacaataga
attggtcatcattgtattagagttgaaaatattagaccaggttatagaatcttaaaatta
aaaaataattttaatagaacaattccattagctaatttattatgtaaatttacatttgtt
gaataa

DBGET integrated database retrieval system