KEGG   Deinococcus deserti: Deide_3p00170Help
Entry
Deide_3p00170     CDS       T00880                                 

Definition
(GenBank) putative diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ddr  Deinococcus deserti
Brite
Enzymes [BR:ddr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Deide_3p00170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
p3:23102..25003
Genome map
AA seq 633 aa AA seqDB search
MDFRDDPPQPASLIQAGAGLTGAIATALLQTSLDCMIVIDQNNLVVEWNPAAEQVFSYSR
QDTLGRNLSTLIIPPAFREGHERGMRRYLTTRIPRIANRVKVFAQRRNGDTFPCEIAFHP
LEFSGSTFFAAVLRDISEQIRTEEVLRESEERYRTIFDQAALGIAHVSVKGHWERVNQTL
CHILGYTHEDLLALTYPDVTHQDDLEQVKEHAELLLSDGVHTSCIQHRFVRRDQSVVWVK
VTSSVMRKASGEAQSFIAMVEDITEIQRAEEELRLAAEDLERRVEARTADLTNLSAQLQT
QVLELEQRNRETRLLGEMSDMLQACLTISEVEQVVAQHASELFPGVGGALYAFESSRTVL
QETISWNGGSSSSSVFVPVECWGLRRGRPFSALGEEGLHCRHSSASHSTLCVPMLAQGET
VGLLHLEAGSAAPLTRRQERLAQTVAETAALAIVNLRLRESLRQQSIRDPLTGLYNRRYL
EESFERELHRAQRSDDPIAVIMLDIDHFKHFNDSHGHEAGDELLRALGQLLSGCIRAEDV
ACRYGGEEFAMVFPGMTLDQATRWADQLRHTVESTQFASRGEALEQVSVSLGVAAFPQHG
RHLADLIRAADAALYRAKREGRNRVITADGASR
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggattttagggatgaccctccgcaacccgcttctctgatccaggccggtgccggactg
accggggccattgccacggccctcctacagacgtcgctggactgcatgatcgttatagac
cagaacaacctggtggtggaatggaacccggcagcggagcaggtgttttcctacagccgt
caggacacgttaggaaggaatctgagcacgctgattatcccgcctgcgttccgcgagggc
catgaacgaggcatgcgccggtacctgaccacacgtattccccgtatcgccaaccgtgtc
aaggtttttgctcagcgccgcaatggcgatacctttccctgcgaaatcgcctttcatccc
ctggagttcagcggctctaccttctttgctgccgtattgcgtgacatcagcgaacagatt
cgtaccgaggaggtcctgcgggaaagcgaggagcggtaccgtacgatctttgatcaggcg
gctctggggattgcccatgtcagtgtgaaggggcactgggagcgcgtgaatcagacgctt
tgccatatcctgggatacacgcatgaagaccttctggcgctgacctatccggacgtaacg
caccaggacgatctggagcaggtcaaggagcatgccgaactgctgctgtcggatggagtc
catacctcgtgcattcagcaccgcttcgttcgccgggaccagtctgtggtgtgggtgaaa
gtcacgagttctgtgatgcgcaaggcaagcggcgaggcccagtcgtttatcgccatggtc
gaagacatcactgagatccagcgcgcggaggaggaacttcggttggccgcagaggatctc
gaacggcgtgtcgaggcccgtacggctgacctgacgaacctcagcgcgcagcttcagacg
caggtgctcgaacttgagcagcggaaccgtgaaacgcgtctcctgggtgaaatgagcgac
atgctgcaggcctgcctgactatttcggaagttgaacaggtggtggcgcaacatgcctcc
gaattgtttccgggcgtgggcggggcattgtatgccttcgaatcgtccaggacagttctt
caggagaccatcagctggaacggtggcagctcaagttcgtcggtctttgtgccggtcgaa
tgctggggcctgcgccggggccgacccttctcggccctcggcgaggaagggcttcattgc
cgtcacagttctgcctctcattccaccctgtgtgttccgatgttggcccagggagaaacg
gtcggactcctgcacctggaggctggcagtgcagcgccgttgaccaggcggcaggaacgg
cttgcgcagaccgttgctgagacggcggccctggcaatcgtgaacttaaggctccgcgag
agccttcgtcagcagtccatccgggatcccctgacggggctctacaaccggcgttacctg
gaggaatccttcgaacgcgaactgcaccgcgctcagcgcagtgatgatcctattgccgtc
atcatgctggatatcgaccatttcaaacacttcaatgactcgcacggtcatgaggccggg
gatgaactgctgcgggccctgggtcagctcctgtcaggatgtatccgcgcggaggatgtg
gcctgccgctacgggggagaggagttcgctatggtgtttcccggcatgactctggaccag
gcgacacggtgggccgatcagctgcgccatacggtcgaaagcacacagttcgcaagtcgc
ggtgaagccctggagcaggtcagcgtctcccttggtgtagccgcctttccgcagcatggc
cgccatctggccgatctgatccgggctgcggacgctgccttgtaccgggcaaaacgcgag
gggcgaaaccgtgtcatcacggcagacggtgcctcaagataa

DBGET integrated database retrieval system