KEGG   Deinococcus gobiensis: DGo_CA0939Help
Entry
DGo_CA0939        CDS       T01827                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00340  Histidine metabolism
dgo01100  Metabolic pathways
dgo01110  Biosynthesis of secondary metabolites
dgo01230  Biosynthesis of amino acids
Module
dgo_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    DGo_CA0939 (hisD)
Enzymes [BR:dgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     DGo_CA0939 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFD24866
UniProt: H8GYT9
Position
1032043..1033452
Genome map
AA seq 469 aa AA seqDB search
MQVLQGEQARTALTRTFDQIPVPEAVARRIEQTFGEPLSPEQVVERILSDVRARGDDALR
DWTEKLDGARPEALEVSAGELAAARVDDDLHAALRLAISRVRAFYAAQPAHGFLEHGPDG
ALGQLVRPLSRVGVYVPGGLAPLISTLIHTAVPAQVAGVEEIVVTTPPDREGRVHPAILV
AARELGIARVFRVGGAQAIGALAYGTASIPAVDKVAGPGNLFVVIAKRMVYGQVGIESLP
GPTETLVVADDSADPRFVAADLLAQAEHNGAEPVLVSTSRELLLTVQGELMGQLEALPEP
NRGWARDSVSARMKVILAASLDEALELSNLYAPEHLCLLTRDPWSLLGRVRRAGGVFVGE
ASMEALGDYVAGPSHVMPTGGTARFMSPVNVRDFQNIISVVGVNESALRRIGPAAAALAR
AEGLEAHARAVESRLHPADGDAGTDAAVPGVSVPGLAGVVGAPGDLGDL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgctgcaaggtgaacaggcccgcaccgccctgacccggaccttcgaccagatt
ccggtgccggaggcggtggcccggcgcatcgaacagaccttcggagagccgctgagcccc
gaacaggtcgtggagcgcatcctgagcgacgtgcgcgcgcgcggcgacgacgccctgcgc
gactggaccgagaagctcgacggcgcgcgtccggaggcgctggaagtctcggccggagaa
ctggcggcggcccgcgtggacgacgacctgcacgcggccctgcggctggcgatctcgcgg
gtgcgggccttctacgccgcgcagcccgcgcacggctttctggaacacggtcccgacggc
gcgctggggcagctcgtgcgcccgctctcgcgcgtcggggtgtacgtgcccggcggcctc
gcgccgctgatctccaccctgatccacaccgccgtgcccgcgcaggtggccggggtagag
gagatcgtcgtgacgaccccgccggaccgcgaaggccgggtccaccccgcgatcctggtc
gcggcgcgcgaactgggcatcgcccgggtgttccgggtgggcggcgcgcaggccatcggg
gcgctcgcctacggcacggccagcattccggcggtggacaaggtggcgggaccgggcaac
ctgttcgtggtgatcgccaagcgcatggtgtacggccaggtgggcatcgagagcctgccc
ggcccgaccgagacgctggtggtggccgacgacagcgccgatccccgcttcgtggccgcc
gacctgctggcgcaggccgagcacaacggggccgagccggtgctcgtctcgacgagccgc
gagctgctgctgaccgtgcagggcgaactcatgggccagctcgaagcgctgcccgaaccc
aaccggggctgggcgcgcgacagcgtctcggcgcgcatgaaagtgatcctggcggcgtcg
ctcgacgaggcgctggaactgtcgaacctctacgcgcccgagcacctgtgcctgctgacc
cgcgacccctggagcctgctgggccgggtgcggcgggccgggggcgtgttcgtgggcgag
gcgagcatggaggcgctgggcgactatgtggccgggccgagccacgtcatgccgaccggg
ggcacggcccgtttcatgagtccggtcaacgtgcgcgacttccagaacatcatcagcgtg
gtgggcgtgaacgagtcagcgctgcggcgcatcggcccggccgccgccgcgctcgcccgc
gccgagggcctcgaagcccacgcgcgggcggtcgagagccgcctgcacccggccgacggg
gacgccgggaccgacgcggccgtgccgggtgtcagcgtgccgggactggcgggcgtggtg
ggcgctccgggggacctcggcgacctatga

DBGET integrated database retrieval system