KEGG   Deinococcus gobiensis: DGo_CA2485Help
Entry
DGo_CA2485        CDS       T01827                                 

Gene name
echA
Definition
(RefSeq) Enoyl-CoA hydratase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dgo  Deinococcus gobiensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    DGo_CA2485 (echA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DGo_CA2485 (echA)
   00650 Butanoate metabolism
    DGo_CA2485 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    DGo_CA2485 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DGo_CA2485 (echA)
   00310 Lysine degradation
    DGo_CA2485 (echA)
   00360 Phenylalanine metabolism
    DGo_CA2485 (echA)
   00380 Tryptophan metabolism
    DGo_CA2485 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DGo_CA2485 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DGo_CA2485 (echA)
   00281 Geraniol degradation
    DGo_CA2485 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DGo_CA2485 (echA)
   00627 Aminobenzoate degradation
    DGo_CA2485 (echA)
   00930 Caprolactam degradation
    DGo_CA2485 (echA)
Enzymes [BR:dgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DGo_CA2485 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2642212..2642970
Genome map
AA seq 252 aa AA seqDB search
MTNESVRLSRRTTEGGQEVATLTITSKMGAMGPEFWRGAAQALSDLGGARVLTVRGEGLF
SAGLDVKASAADLLPVLGDEAGFAAVVAGMHAVTEGVAALPIPVIVAAHGWCIGAGLELA
AAADLRLCSADARFMLPEVRLGIAADLGGLQRLPGLIGRGRAAHLALTGQPIDAATAERW
GLVTEVLPDPEALFTRADALADALAVLPPHALEGTKRSLNAEGPHAGRLAADVAWNARYM
TAEGLQAALRKA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgagagtgttcggctcagtcgccggaccaccgaggggggccaggaggtcgcc
acgctgaccatcacctccaagatgggggcgatggggccggagttctggcgcggcgcggcg
caggccctgtccgacctgggcggcgcgcgggtgctgaccgtgcgcggcgagggcctgttc
agcgccgggctggacgtgaaggccagcgccgccgacctgctgcccgtgctgggcgacgag
gccggtttcgcggcggtcgtggccgggatgcacgcggtcaccgaaggtgtggccgcgctg
cccatcccggtgatcgtggccgcgcacggctggtgcatcggcgcggggctggaactcgcg
gcggcggccgacctgcggctgtgcagcgccgacgcccggttcatgctgcccgaggtgcgc
ctgggcatcgcggccgacctggggggcctccagcgcctgccggggctgatcgggcggggc
cgcgcggcgcacctcgccctgaccggccagccgatcgacgccgccaccgccgaacgctgg
ggcctggtgaccgaggtgctgcccgaccccgaggccctgttcacgcgggccgatgccctt
gccgacgccctggccgtcctgcccccccacgcgctggagggcaccaagcggtccctgaac
gccgaagggccgcacgccgggcgcttggccgccgacgtcgcctggaacgcccgctacatg
accgccgaggggctgcaagcggccctgcgcaaagcctga

DBGET integrated database retrieval system