KEGG   Deinococcus gobiensis: DGo_CA2485Help
Entry
DGo_CA2485        CDS       T01827                                 

Gene name
echA
Definition
(GenBank) Enoyl-CoA hydratase, putative
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00071  Fatty acid degradation
dgo00280  Valine, leucine and isoleucine degradation
dgo00281  Geraniol degradation
dgo00310  Lysine degradation
dgo00360  Phenylalanine metabolism
dgo00362  Benzoate degradation
dgo00380  Tryptophan metabolism
dgo00410  beta-Alanine metabolism
dgo00627  Aminobenzoate degradation
dgo00640  Propanoate metabolism
dgo00650  Butanoate metabolism
dgo00903  Limonene and pinene degradation
dgo00930  Caprolactam degradation
dgo01100  Metabolic pathways
dgo01110  Biosynthesis of secondary metabolites
dgo01120  Microbial metabolism in diverse environments
dgo01130  Biosynthesis of antibiotics
dgo01212  Fatty acid metabolism
Module
dgo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DGo_CA2485 (echA)
   00650 Butanoate metabolism
    DGo_CA2485 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    DGo_CA2485 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DGo_CA2485 (echA)
   00310 Lysine degradation
    DGo_CA2485 (echA)
   00360 Phenylalanine metabolism
    DGo_CA2485 (echA)
   00380 Tryptophan metabolism
    DGo_CA2485 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DGo_CA2485 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DGo_CA2485 (echA)
   00281 Geraniol degradation
    DGo_CA2485 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DGo_CA2485 (echA)
   00627 Aminobenzoate degradation
    DGo_CA2485 (echA)
   00930 Caprolactam degradation
    DGo_CA2485 (echA)
Enzymes [BR:dgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DGo_CA2485 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFD26412
UniProt: H8GS21
Position
2642212..2642970
Genome map
AA seq 252 aa AA seqDB search
MTNESVRLSRRTTEGGQEVATLTITSKMGAMGPEFWRGAAQALSDLGGARVLTVRGEGLF
SAGLDVKASAADLLPVLGDEAGFAAVVAGMHAVTEGVAALPIPVIVAAHGWCIGAGLELA
AAADLRLCSADARFMLPEVRLGIAADLGGLQRLPGLIGRGRAAHLALTGQPIDAATAERW
GLVTEVLPDPEALFTRADALADALAVLPPHALEGTKRSLNAEGPHAGRLAADVAWNARYM
TAEGLQAALRKA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgagagtgttcggctcagtcgccggaccaccgaggggggccaggaggtcgcc
acgctgaccatcacctccaagatgggggcgatggggccggagttctggcgcggcgcggcg
caggccctgtccgacctgggcggcgcgcgggtgctgaccgtgcgcggcgagggcctgttc
agcgccgggctggacgtgaaggccagcgccgccgacctgctgcccgtgctgggcgacgag
gccggtttcgcggcggtcgtggccgggatgcacgcggtcaccgaaggtgtggccgcgctg
cccatcccggtgatcgtggccgcgcacggctggtgcatcggcgcggggctggaactcgcg
gcggcggccgacctgcggctgtgcagcgccgacgcccggttcatgctgcccgaggtgcgc
ctgggcatcgcggccgacctggggggcctccagcgcctgccggggctgatcgggcggggc
cgcgcggcgcacctcgccctgaccggccagccgatcgacgccgccaccgccgaacgctgg
ggcctggtgaccgaggtgctgcccgaccccgaggccctgttcacgcgggccgatgccctt
gccgacgccctggccgtcctgcccccccacgcgctggagggcaccaagcggtccctgaac
gccgaagggccgcacgccgggcgcttggccgccgacgtcgcctggaacgcccgctacatg
accgccgaggggctgcaagcggccctgcgcaaagcctga

DBGET integrated database retrieval system