KEGG   Debaryomyces hansenii: DEHA2C00792gHelp
Entry
DEHA2C00792g      CDS       T01026                                 

Definition
DEHA2C00792p
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dha  Debaryomyces hansenii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DEHA2C00792g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     DEHA2C00792g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:86015..87325
Genome map
AA seq 436 aa AA seqDB search
MLFIWCNILTNVVAASILPQASFQIDGLLAGDPSIMESVPNIITEQVVSHYESKNYNFLD
EYFGQVYFGDYSDLEKTIRKQKTSLWASREVTYPDKDDITDIVSGRSDRYVSNPLSGFLS
FAHLPLTNCFSGETKFDIGIVGATFDTGVSFRPGSRFGPLGIRMATKRMSSGSISPFRKN
FSLFKDGKIVDCGDPPMTPIDNRIALDQLYRAERAILKTKPTTPSLSKVSRILTLGGDHT
VTLSCLRAVYEKWGKVAVIHFDSHLDTIDPYQMNENVTEYAALNHGTFFHWAAKRGLISE
SKNVHVGLRGYYENLNDTQRDSAIGFERIMSRDIDDIGIAGIVKRIKDRVGDSKVYITVD
IDSLDPSSAPGTGTVEPGGFSSRELLTILDKLEGLEVIGADVVEVAPPYDTNEITTMVAS
EVARSLLGLMVITPVQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgctattcatttggtgtaatattttgacaaatgttgttgcggcttcgatcttgcctcaa
gccagctttcaaattgacgggctattagcaggcgaccccagcataatggaatcagttccg
aatataatcacagaacaggtagtgctgcattatgaatctaaaaattataattttctagat
gaatactttggacaagtatactttggtgactacagtgatttggaaaagacaattagaaag
caaaagacctctttgtgggcaagtagagaggttacatatccagacaaggatgatattacg
gatattgtttccggtagaagcgatagatacgtaagtaatcctcttagtgggtttctaagt
tttgctcacttaccgttgacaaattgcttttcaggagaaacgaagttcgatattggtatc
gttggggctacttttgatacgggagtgagttttcgccctggttctcgttttggaccatta
ggtatccgaatggcaacgaaaaggatgtcttcgggaagcatttcacctttcaggaagaac
tttagtctctttaaggatgggaagatcgttgactgtggtgatccacctatgacccctatt
gataatagaattgctctagaccaactttatagggcagaacgtgctatattgaaaactaaa
cctacaactcctagtctttcgaaagtttcaaggattttaaccttaggaggggaccataca
gtaactctaagttgtttgcgggcggtttacgaaaaatggggaaaagtagctgttatccat
tttgatagtcatttagacacaattgacccttatcaaatgaatgaaaacgttactgaatat
gctgctttgaatcatggcactttcttccattgggctgcaaaacgtggcttgatttcggag
agtaaaaatgttcacgttggtcttcgagggtattatgaaaacttgaacgatactcaaaga
gattcagccataggttttgaaagaataatgagcagagacatcgatgatattggaattgct
ggaattgtaaaacgaataaaggatagagtgggtgactcaaaggtatatataacagtagat
attgattcactcgatcccagttctgcacctggaaccggaacagttgaacccggtggattt
agtagcagagaattgttaacaatattggacaagttagaaggtctagaagttattggagcg
gacgtggttgaggttgcaccaccgtacgacacgaatgaaataactacgatggtagcgagc
gaggtagcaagaagcttgcttggacttatggtaattactcctgttcaataa

DBGET integrated database retrieval system