KEGG   Debaryomyces hansenii: DEHA2E21054gHelp
Entry
DEHA2E21054g      CDS       T01026                                 

Definition
(RefSeq) DEHA2E21054p
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dha  Debaryomyces hansenii
Pathway
dha00010  Glycolysis / Gluconeogenesis
dha00260  Glycine, serine and threonine metabolism
dha00680  Methane metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
dha01200  Carbon metabolism
dha01230  Biosynthesis of amino acids
Module
dha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dha_M00002  Glycolysis, core module involving three-carbon compounds
dha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2E21054g
  Energy metabolism
   00680 Methane metabolism
    DEHA2E21054g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DEHA2E21054g
Enzymes [BR:dha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DEHA2E21054g
Membrane trafficking [BR:dha04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    DEHA2E21054g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DEHA2E21054g
  Exosomal proteins of melanoma cells
   DEHA2E21054g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF4047
Motif
Other DBs
NCBI-GeneID: 2902853
NCBI-ProteinID: XP_460219
UniProt: Q6BNK1
Position
E:complement(1741374..1742120)
Genome map
AA seq 248 aa AA seqDB search
MVKLILVRHGQSTWNEKNLFTGWVDCRLSDIGEKEAARAGELLKEANLKGDVLYTSKLSR
AIQTANIALNTADQLYIPVKRSWRLNERHYGALQGKDKAATLEEYGQEKFQTWRRSFDVP
PPVIADDSEFSQAGDERYRDVDPSVLPKTESLKLVIDRLLPYWQDEISKDLLEGKTVIVA
AHGNSLRALVKHLDNISDDDIAGLNIPTGIPLVYELDEKLQPTKPAYYLDPEAAAAGAAA
VAAQGSKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggttaaattaatcttagttagacacggacaatccacatggaacgaaaagaacttattc
accggttgggttgattgtcgtttgtccgacattggtgaaaaggaagctgccagagctggt
gaattattaaaggaagccaacttaaagggtgacgttttatacacctccaagttatctaga
gctattcaaactgccaacattgctttgaacactgctgatcaattgtacattccagtcaag
agatcgtggagattaaacgaaagacactacggtgctttacaaggtaaggataaggctgcc
accttagaagaatacggtcaagaaaagttccaaacttggagaagatcatttgacgttcca
ccaccagtcatcgccgatgactctgagttctcccaagctggtgacgaacgttacagagac
gtcgacccatctgtattaccaaagaccgaatctttgaaattggttatcgacagattgttg
ccatactggcaagacgaaatctctaaggacttattggaaggtaagactgtcattgtcgct
gcccacggtaactccttaagagcattggttaagcacttggacaacatctctgatgacgat
attgccggcttaaacattccaaccggtattccattagtttatgaattagacgaaaaatta
caaccaaccaagccagcttactacttagacccagaagctgctgctgctggtgccgctgct
gttgctgcccaaggttcaaagaaataa

DBGET integrated database retrieval system