KEGG   Debaryomyces hansenii: DEHA2F14498gHelp
Entry
DEHA2F14498g      CDS       T01026                                 

Definition
DEHA2F14498p
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
dha  Debaryomyces hansenii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:dha00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    DEHA2F14498g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     DEHA2F14498g
Protein kinases [BR:dha01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   DEHA2F14498g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1223745..1225259
Genome map
AA seq 504 aa AA seqDB search
MMRLNNDSSTSIGSNKDKKLPPIPNSQENEAKTTNIIPNEDSILESKTLKRKNFKKLSLD
SPSTTSTPSASQAENTSTDMGLRYPPSSKSGRIRPAPLMNLNRNSQGKLNINQSNRNIDP
DTQSSTDVIINHFSNLELSNMNKRNPSIASRKRQTVISSISPTKSSASSPNDANLNSLNL
TDQQSPIATTSSIKLNNNDLLTLKNLGSGNSGTVSKILHIPTQKTMAKKIIHIDSKSVIQ
TQIIRELRILHECQSPFIIEFYGAFINNNNTIVICMEYCNCGSLDKILPLCQNNQFPLFV
LKKLSYAILSGLTYLYSTHKIIHRDIKPSNVLMNHKGEFKLCDFGVSRELTNSLAMADTF
VGTSTYMSPERIQGLTYGVKSDVWSMGLMLIELARGIPVWVDDGEEEGPQGPEGILDLLQ
RIVNEAPPSLANKTNTTTNQPFDDILCKFIDSCLIKDDNLRKSPWDLLNEPQGFISGVEK
GLYDKDVKVWAKGIRKLHKEKNES
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgattgaataatgattcgctgacttcaataggatcaaacaaagacaagaagtta
cccccaatcccgaattcacaggaaaatgaagcaaaaaccaccaatattataccaaatgag
gatctgatattagaatccaagacattgaaacgtaagaatttcaagaaattgtcattagac
tcaccatcaacaacatctacaccatcagcatcgcaagcagaaaatacgtcaacagacatg
ggattacgatacccacctagctctaagtcgggtagaattagaccagcaccattgatgaat
ttaaacaggaactcacagggtaaattaaacatcaatcaaagtaatagaaatatagaccca
gatacacagtcgtctacggatgttattataaaccatttttcgaatcttgagttatcaaat
atgaataagaggaacccttcgattgcaagcagaaaaagacaaacagttatttcctccata
tctccaacgaaatctagtgcatcatctccgaacgatgcaaatttgaattctctaaactta
acagatcaacaatcgcctatcgcgacgacatcctcgataaaattgaataataatgacttg
ttgacgttgaagaatttgggttctgggaactcagggactgtttcgaagatccttcatatt
ccaacacagaaaacaatggctaaaaaaataatacatatcgatctgaaaagtgtcattcag
actcagataataagggagttacggatattacacgaatgccaatctccatttattattgaa
ttttacggagcttttattaataataacaacacaatagtgatttgcatggaatactgtaat
tgtgggtctttagataaaatcttaccactttgtcagaataatcaatttcccttatttgta
ttaaagaagttgtcctatgcaattctatcggggttaacctatttatattctacgcataaa
atcatccatcgagatattaaaccaagcaatgtcctaatgaatcataaaggtgaatttaaa
ttatgtgatttcggtgtcctgagagaattgactaattcgctcgcgatggcggacactttt
gtggggacatcaacatatatgtcaccagagagaatacaaggtttgacttatggtgtaaag
tcagatgtttggtctatgggtttaatgttgatcgaattagcaaggggaatccctgtttgg
gtagacgatggtgaggaggaaggtcctcaaggccctgagggtattctagatttgttgcaa
agaatcgtcaacgaggcgcctccttccttagccaataagactaacacaacaacaaatcaa
ccgttcgatgatatattatgtaaatttatcgattcttgtctaataaaggatgacaatttg
agaaaatcaccatgggatttattaaatgaaccccaaggattcatatcgggagtcgaaaag
gggctttacgataaagacgtcaaggtgtgggccaaagggataagaaaattgcataaagaa
aagaatgagagttag

DBGET integrated database retrieval system