KEGG   Desulfotomaculum kuznetsovii: Desku_3303Help
Entry
Desku_3303        CDS       T01499                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku00010  Glycolysis / Gluconeogenesis
dku00052  Galactose metabolism
dku00500  Starch and sucrose metabolism
dku00520  Amino sugar and nucleotide sugar metabolism
dku00521  Streptomycin biosynthesis
dku01100  Metabolic pathways
dku01110  Biosynthesis of secondary metabolites
dku01120  Microbial metabolism in diverse environments
dku01130  Biosynthesis of antibiotics
dku01200  Carbon metabolism
Module
dku_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desku_3303
   00052 Galactose metabolism
    Desku_3303
   00500 Starch and sucrose metabolism
    Desku_3303
   00520 Amino sugar and nucleotide sugar metabolism
    Desku_3303
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desku_3303
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Desku_3303
Enzymes [BR:dku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Desku_3303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AEG16789
JGI: Desku_3303
UniProt: F6CN93
Position
complement(3323316..3324302)
Genome map
AA seq 328 aa AA seqDB search
MKGLVAAVDLGGTKIYTALADQSGRVLAEVVVPTRPWEGAGAVIGRIVETVDQVLKQAGE
QGPPLALGIGAPGPLNAATGVVYQAPNLGWDNVPLKQKLEEILDVPVVVDNDANLAAMGE
YVYGAGRGEEEMVYITVSTGIGGGLILRGRVYHGAGYGAGEIGHMTIDPNGPRCGCGNYG
CLEAMASGTAMAREARRLVESGGGRAILEAAGGDVDAITAREVARAAAAGDGEARQIIIN
AGRALGIGVANVINLLNPALVVLGGGAMQVGPLLWDAMEREVSRRAWAPARRRVRLVPAE
LGGRSGLMGAVALALQKVRGEKPPNPVV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagggattggttgccgccgttgacctgggtggtacgaaaatttataccgctctggct
gaccagagcggccgcgtgctggccgaagtggtggttcccacccggccctgggagggagcc
ggggcagtaatcggacggattgtggagacggtggaccaggtattaaaacaggccggggag
caagggccgcccctggccctggggattggtgcccccggtcctctgaacgccgccaccggg
gtggtgtaccaggcgcccaatctgggttgggacaatgttcccctgaagcaaaagctggag
gaaatactggatgttcccgtggtggtggacaatgatgccaacctggccgccatgggggaa
tatgtctacggggccgggcgcggcgaggaggagatggtctacattaccgtcagtaccggt
atcgggggcggcctgatcctgcgggggcgggtgtaccatggtgccggctacggggccggc
gaaatcggtcacatgaccatagatcccaacggcccccggtgtggctgcggcaattacggc
tgcctggaggccatggcttccgggacggccatggcccgggaggcccgccgcctggtggag
tccggcgggggcagggctattctggaggcggcgggaggggatgtggacgccatcaccgcc
cgggaggtggcccgggcggccgccgcgggtgacggcgaggcccggcaaatcatcattaac
gccgggcgggccctgggtatcggcgtggccaacgtgatcaacctgttgaatccggccctg
gtggtgctggggggcggggccatgcaggtgggaccccttttatgggacgccatggaaagg
gaagtatcccggcgcgcctgggcccctgcccgcaggcgggtgcggctggtgccggcggag
ctgggcgggcggtccggtttaatgggggcggtggccctggcccttcagaaggtgcggggg
gaaaaacctcccaatcccgtggtataa

DBGET integrated database retrieval system