KEGG   Drosophila melanogaster (fruit fly): Dmel_CG13397Help
Entry
Dmel_CG13397      CDS       T00030                                 

Gene name
CG13397
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K01205  alpha-N-acetylglucosaminidase [EC:3.2.1.50]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00531  Glycosaminoglycan degradation
dme01100  Metabolic pathways
dme04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dmel_CG13397 (CG13397)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dmel_CG13397 (CG13397)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.50  alpha-N-acetylglucosaminidase
     Dmel_CG13397 (CG13397)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG13397 (CG13397)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAGLU NAGLU_C NAGLU_N
Motif
Other DBs
NCBI-GeneID: 46386
NCBI-ProteinID: NP_001260251
FlyBase: FBgn0014417
UniProt: Q9VLL5
Position
2L
AA seq 778 aa AA seqDB search
MQLNWKLALALLAVLCLQLAQGSELNWDAASGPEMGLQMAAHLAPSTPKDVQETAAMAVI
SRVIGERSSQLFKVQVNKNMDLRSFQISMLDDGRILLMGWDGVSVCKALHHYLKYVLNKD
VDWFKMRIELPTNLQLPNVTIESKSASPIIYHQNVCTWSYSFAWWGIEQWRRHLDWMALM
GISLTIAPVQEAIWVKVYTDMGLRMEEIDEHLAGPAFQAWQRMGNIRGWAGPLTPAWRRY
QLLLQQEIITAQRNLGMSVALPAFAGHVPRALKRLNPESTFMEVQRWNQFPDRYCCGLFV
EPTENLFKEIASRFLHNIITKYGSNHIFFCDPFNELEPPVAKPEYMRSTAAAIYESMRGI
DPQAIWLLQGWMFVKNPFWTTDMAEAFLTAAPRGRILVLDLQSEQFPQYELTRSYFGQPF
IWCMLHNFGGTLGMFGSAKLINSGIEEARRLPNSSLVGTGITPEGIGQNYVMYSFTLERG
WSNTSLDLDSWFTNFSHSRYGVKDERLEQAWLLLKNSVYSFRGLQKMRGQYVVTRRPSFN
QEPFTWYNASAVLDAWHLLLTFRAIIPLEDNRYEIYEHDLVDITRQFLQISADQLYINLR
SAYRKRQVSRFEFLSVKLLKLFDDMELILASSRNFLLGNWLQQAKQAAPNTGQQRNFEFN
ARNQITAWGPDGQILDYACKQWSGLVSDYYRPRWRLFLEDVTVALHAGRPFNGTAFKLKV
SHEIELPFSNKDDVYPVTPVGNTWLISQDIFETWKGYSKDTLFLHNNRLSVPQKAGPK
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgaattggaagctggccttggccttgctagcggtgctttgcctgcaactcgcg
cagggatcagaacttaactgggatgcggcttcaggtcctgaaatgggactccaaatggct
gcccacttggcacccagcacacccaaagatgtccaggaaaccgcagccatggcggtaatc
agtagagtaatcggcgaacgatcttctcaattgtttaaggtgcaagtcaataaaaatatg
gatttacgaagctttcagattagcatgttggatgatggccggattctgctgatgggatgg
gatggtgtttccgtgtgcaaggccctccatcactacctcaaatatgttttaaacaaggac
gtggattggttcaagatgcgcattgagttgcccaccaatttgcagctgcccaatgtgacc
atcgagtccaagtcagcaagcccgattatctatcaccagaacgtgtgcacttggagctat
agctttgcatggtggggcattgagcagtggcgccgtcacctggactggatggccctgatg
ggcatcagtctgactattgcgccggtccaggaagccatttgggtgaaggtgtacacggat
atgggcctcaggatggaggaaatcgacgagcatctggctggaccagcttttcaggcctgg
cagcgcatgggcaacatacggggatgggcgggaccactgacaccggcatggcgacgctat
caattactcctccagcaggagattatcactgcccaacgcaatctgggcatgagcgtggcc
ttgcccgcctttgctggtcatgtgccacgtgctctgaagcgtctgaatcccgaatcgacg
ttcatggaagtgcagcgatggaaccagttccccgatcgatactgctgcggtttatttgtg
gaacccacggagaatcttttcaaggagatagcctcgcgttttttgcataatatcattacg
aaatatggttcgaatcacatcttcttctgcgatcccttcaacgaactggagccaccggta
gccaagccggaatacatgcgttcaacggcggcggcgatttatgaatctatgcgcggcatt
gatcctcaggccatttggttgcttcagggctggatgttcgtgaagaatcccttttggacc
acggacatggctgaagctttcctcacggccgcaccacgtggtcgcattttggtgctcgat
ctgcagagcgaacagtttccgcaatacgagctaacgcgctcctactttgggcagcccttt
atatggtgcatgcttcacaatttcggcggcacacttggaatgtttggatcagcgaagctg
ataaattccggaatagaagaggcgcgtcgcttgcccaacagcagtttggtgggcacggga
atcacacccgagggcattggccagaactatgtgatgtattcgttcaccttggagcgcggc
tggagtaatacatccctagatctggatagctggtttacgaatttctcacacagccggtat
ggcgttaaggatgagcgtttggagcaggcgtggctgctcctaaagaatagcgtctattcc
ttccgtggtctgcagaaaatgcggggacagtatgtagtgacgcgcaggccttccttcaac
caagaacccttcacttggtacaatgcaagtgcagtgctggatgcctggcacttgttgctg
accttcagagccatcataccgctagaggataacagatacgagatatacgaacacgatttg
gtggacataaccaggcaattcctgcagatcagcgcagatcagttgtatatcaatctaagg
tcggcctatagaaagcgacaggtttcgcgtttcgaattccttagcgtcaagctgttgaaa
ctgttcgatgacatggagctgatcctggcgagcagcaggaattttctgctcggcaactgg
ctgcagcaggccaagcaagcggcaccgaacactgggcaacaaagaaacttcgaattcaat
gcgagaaaccaaattaccgcctggggtcctgatggtcagatcctggactatgcgtgcaaa
cagtggtccggcttggtgagcgactactataggcctcggtggagactcttcctggaagat
gtgacagtggctctccatgctggacgaccctttaatggtaccgctttcaagctgaaagtc
tcgcacgaaatcgagctgccttttagcaacaaagacgacgtttatcccgtgacgccagtt
ggcaacacctggcttatttcccaggacattttcgaaacctggaagggctactctaaggac
acgctctttctacataacaacagattatcagtgcctcaaaaagcgggacctaaataa

DBGET integrated database retrieval system