KEGG   Drosophila melanogaster (fruit fly): Dmel_CG13397Help
Entry
Dmel_CG13397      CDS       T00030                                 

Definition
CG13397 gene product from transcript CG13397-RB (EC:3.2.1.50)
Orthology
K01205  
alpha-N-acetylglucosaminidase [EC:3.2.1.50]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Lysosome
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dme00531]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dme04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:29C3-29C3
AA seq 778 aa AA seqDB search
MQLNWKLALALLAVLCLQLAQGSELNWDAASGPEMGLQMAAHLAPSTPKDVQETAAMAVI
SRVIGERSSQLFKVQVNKNMDLRSFQISMLDDGRILLMGWDGVSVCKALHHYLKYVLNKD
VDWFKMRIELPTNLQLPNVTIESKSASPIIYHQNVCTWSYSFAWWGIEQWRRHLDWMALM
GISLTIAPVQEAIWVKVYTDMGLRMEEIDEHLAGPAFQAWQRMGNIRGWAGPLTPAWRRY
QLLLQQEIITAQRNLGMSVALPAFAGHVPRALKRLNPESTFMEVQRWNQFPDRYCCGLFV
EPTENLFKEIASRFLHNIITKYGSNHIFFCDPFNELEPPVAKPEYMRSTAAAIYESMRGI
DPQAIWLLQGWMFVKNPFWTTDMAEAFLTAAPRGRILVLDLQSEQFPQYELTRSYFGQPF
IWCMLHNFGGTLGMFGSAKLINSGIEEARRLPNSSLVGTGITPEGIGQNYVMYSFTLERG
WSNTSLDLDSWFTNFSHSRYGVKDERLEQAWLLLKNSVYSFRGLQKMRGQYVVTRRPSFN
QEPFTWYNASAVLDAWHLLLTFRAIIPLEDNRYEIYEHDLVDITRQFLQISADQLYINLR
SAYRKRQVSRFEFLSVKLLKLFDDMELILASSRNFLLGNWLQQAKQAAPNTGQQRNFEFN
ARNQITAWGPDGQILDYACKQWSGLVSDYYRPRWRLFLEDVTVALHAGRPFNGTAFKLKV
SHEIELPFSNKDDVYPVTPVGNTWLISQDIFETWKGYSKDTLFLHNNRLSVPQKAGPK
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgaattggaagctggccttggccttgctagcggtgctttgcctgcaactcgcg
cagggatcagaacttaactgggatgcggcttcaggtcctgaaatgggactccaaatggct
gcccacttggcacccagcacacccaaagatgtccaggaaaccgcagccatggcggtaatc
agtagagtaatcggcgaacgatcttctcaattgtttaaggtgcaagtcaataaaaatatg
gatttacgaagctttcagattagcatgttggatgatggccggattctgctgatgggatgg
gatggtgtttccgtgtgcaaggccctccatcactacctcaaatatgttttaaacaaggac
gtggattggttcaagatgcgcattgagttgcccaccaatttgcagctgcccaatgtgacc
atcgagtccaagtcagcaagcccgattatctatcaccagaacgtgtgcacttggagctat
agctttgcatggtggggcattgagcagtggcgccgtcacctggactggatggccctgatg
ggcatcagtctgactattgcgccggtccaggaagccatttgggtgaaggtgtacacggat
atgggcctcaggatggaggaaatcgacgagcatctggctggaccagcttttcaggcctgg
cagcgcatgggcaacatacggggatgggcgggaccactgacaccggcatggcgacgctat
caattactcctccagcaggagattatcactgcccaacgcaatctgggcatgagcgtggcc
ttgcccgcctttgctggtcatgtgccacgtgctctgaagcgtctgaatcccgaatcgacg
ttcatggaagtgcagcgatggaaccagttccccgatcgatactgctgcggtttatttgtg
gaacccacggagaatcttttcaaggagatagcctcgcgttttttgcataatatcattacg
aaatatggttcgaatcacatcttcttctgcgatcccttcaacgaactggagccaccggta
gccaagccggaatacatgcgttcaacggcggcggcgatttatgaatctatgcgcggcatt
gatcctcaggccatttggttgcttcagggctggatgttcgtgaagaatcccttttggacc
acggacatggctgaagctttcctcacggccgcaccacgtggtcgcattttggtgctcgat
ctgcagagcgaacagtttccgcaatacgagctaacgcgctcctactttgggcagcccttt
atatggtgcatgcttcacaatttcggcggcacacttggaatgtttggatcagcgaagctg
ataaattccggaatagaagaggcgcgtcgcttgcccaacagcagtttggtgggcacggga
atcacacccgagggcattggccagaactatgtgatgtattcgttcaccttggagcgcggc
tggagtaatacatccctagatctggatagctggtttacgaatttctcacacagccggtat
ggcgttaaggatgagcgtttggagcaggcgtggctgctcctaaagaatagcgtctattcc
ttccgtggtctgcagaaaatgcggggacagtatgtagtgacgcgcaggccttccttcaac
caagaacccttcacttggtacaatgcaagtgcagtgctggatgcctggcacttgttgctg
accttcagagccatcataccgctagaggataacagatacgagatatacgaacacgatttg
gtggacataaccaggcaattcctgcagatcagcgcagatcagttgtatatcaatctaagg
tcggcctatagaaagcgacaggtttcgcgtttcgaattccttagcgtcaagctgttgaaa
ctgttcgatgacatggagctgatcctggcgagcagcaggaattttctgctcggcaactgg
ctgcagcaggccaagcaagcggcaccgaacactgggcaacaaagaaacttcgaattcaat
gcgagaaaccaaattaccgcctggggtcctgatggtcagatcctggactatgcgtgcaaa
cagtggtccggcttggtgagcgactactataggcctcggtggagactcttcctggaagat
gtgacagtggctctccatgctggacgaccctttaatggtaccgctttcaagctgaaagtc
tcgcacgaaatcgagctgccttttagcaacaaagacgacgtttatcccgtgacgccagtt
ggcaacacctggcttatttcccaggacattttcgaaacctggaagggctactctaaggac
acgctctttctacataacaacagattatcagtgcctcaaaaagcgggacctaaataa

DBGET integrated database retrieval system