KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15743Help
Entry
Dmel_CG15743      CDS       T00030                                 

Definition
CG15743 gene product from transcript CG15743-RC (EC:3.1.3.7)
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dmel_CG15743
  Energy metabolism
   00920 Sulfur metabolism
    Dmel_CG15743
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Dmel_CG15743
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dmel_CG15743
    3.1.3.25  inositol-phosphate phosphatase
     Dmel_CG15743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:11E9-11E9
AA seq 355 aa AA seqDB search
MSEDKMNGRSIRINRLPATIVAILLTFVLVYFLNFHQEERPAIYGMLRSENPSRVNLRKM
LIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFP
RVQIFSEEDKEHCKQAHGYDLDPTVLHETAQIPDVTVNAQDVTVWVDPLDATKEFTEELY
EYVTTMVCVAVAGRPIIGVIHSPFNGQTAWAWVGNSMSEYLSNLHPQHSPNNQAPIITVS
RSHTAGAKDLARGIFGENVSLLTAAGAGYKVLQVVANNATAYLHTSKIKKWDICAGDAIL
HALGGTMTTLNDQLINYGPEESPVNTEGLLATLEQHDEYMDKLSKYREAHNGKLA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagacaagatgaacggacgctccattcgcatcaaccggctgccggccaccatt
gtggccatcctgctgacctttgtcctggtctacttcctcaatttccatcaggaggagcgg
ccagcgatctacggcatgctgcgcagtgagaatcccagccgcgtcaatctacgcaagatg
ctaatagccgccatacaggccgcccagcgtggcggtctcgaggtactggacgtggcccgg
agtcgccagctgaaggagcgcagcaagggcaagacggacgagggcgtcaatgatcccttc
acggatgccgacggccggtcacattgtgtgatgaagcagggcctgcagcgaatctttccc
cgcgtacaaatcttctccgaggaggacaaggagcactgcaagcaggcacacggctatgat
ctagatccaacggtcctccacgagaccgcacagataccggatgtgaccgtaaatgcccag
gatgtcactgtttgggtagatccgttggatgccaccaaggagttcaccgaggagctatac
gagtacgtgaccaccatggtgtgcgtggcagtggccggaaggcccatcattggcgtgatc
cacagcccgttcaatggacaaaccgcgtgggcgtgggtgggcaactcgatgtctgagtac
ctatccaatctgcatccgcagcattcgccaaacaatcaggcgcccatcattacagtctcg
cgatcccacacggcaggtgccaaggatctggcgaggggcatctttggcgagaatgtcagc
ctgctgacggcggcgggagctggctacaaggtgctccaggtggtggccaacaatgccacc
gcctatttgcacacgtcgaagatcaagaagtgggacatttgcgccggcgatgctattctg
cacgcattgggcggcacaatgaccacgctgaacgatcagttgattaactacggaccagag
gaatcgccagtcaatacggagggcctgctggccaccttggagcagcatgacgagtacatg
gacaagctgtccaaatatcgcgaggcgcacaatggcaagctggcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system