KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15743Help
Entry
Dmel_CG15743      CDS       T00030                                 

Definition
CG15743 gene product from transcript CG15743-RA (EC:3.1.3.7)
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dme00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dme00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dme04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:11E9-11E9
AA seq 355 aa AA seqDB search
MSEDKMNGRSIRINRLPATIVAILLTFVLVYFLNFHQEERPAIYGMLRSENPSRVNLRKM
LIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFP
RVQIFSEEDKEHCKQAHGYDLDPTVLHETAQIPDVTVNAQDVTVWVDPLDATKEFTEELY
EYVTTMVCVAVAGRPIIGVIHSPFNGQTAWAWVGNSMSEYLSNLHPQHSPNNQAPIITVS
RSHTAGAKDLARGIFGENVSLLTAAGAGYKVLQVVANNATAYLHTSKIKKWDICAGDAIL
HALGGTMTTLNDQLINYGPEESPVNTEGLLATLEQHDEYMDKLSKYREAHNGKLA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagacaagatgaacggacgctccattcgcatcaaccggctgccggccaccatt
gtggccatcctgctgacctttgtcctggtctacttcctcaatttccatcaggaggagcgg
ccagcgatctacggcatgctgcgcagtgagaatcccagccgcgtcaatctacgcaagatg
ctaatagccgccatacaggccgcccagcgtggcggtctcgaggtactggacgtggcccgg
agtcgccagctgaaggagcgcagcaagggcaagacggacgagggcgtcaatgatcccttc
acggatgccgacggccggtcacattgtgtgatgaagcagggcctgcagcgaatctttccc
cgcgtacaaatcttctccgaggaggacaaggagcactgcaagcaggcacacggctatgat
ctagatccaacggtcctccacgagaccgcacagataccggatgtgaccgtaaatgcccag
gatgtcactgtttgggtagatccgttggatgccaccaaggagttcaccgaggagctatac
gagtacgtgaccaccatggtgtgcgtggcagtggccggaaggcccatcattggcgtgatc
cacagcccgttcaatggacaaaccgcgtgggcgtgggtgggcaactcgatgtctgagtac
ctatccaatctgcatccgcagcattcgccaaacaatcaggcgcccatcattacagtctcg
cgatcccacacggcaggtgccaaggatctggcgaggggcatctttggcgagaatgtcagc
ctgctgacggcggcgggagctggctacaaggtgctccaggtggtggccaacaatgccacc
gcctatttgcacacgtcgaagatcaagaagtgggacatttgcgccggcgatgctattctg
cacgcattgggcggcacaatgaccacgctgaacgatcagttgattaactacggaccagag
gaatcgccagtcaatacggagggcctgctggccaccttggagcagcatgacgagtacatg
gacaagctgtccaaatatcgcgaggcgcacaatggcaagctggcgtag

DBGET integrated database retrieval system