KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2171Help
Entry
Dmel_CG2171       CDS       T00030                                 

Gene name
Tpi
Definition
(RefSeq) Triose phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dmel_CG2171 (Tpi)
   01230 Biosynthesis of amino acids
    Dmel_CG2171 (Tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG2171 (Tpi)
   00051 Fructose and mannose metabolism
    Dmel_CG2171 (Tpi)
   00562 Inositol phosphate metabolism
    Dmel_CG2171 (Tpi)
Enzymes [BR:dme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dmel_CG2171 (Tpi)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dmel_CG2171 (Tpi)
  Exosomal proteins of bladder cancer cells
   Dmel_CG2171 (Tpi)
  Exosomal proteins of melanoma cells
   Dmel_CG2171 (Tpi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:99D8-99D8; 3R:3-101.3 cM
AA seq 247 aa AA seqDB search
MSRKFCVGGNWKMNGDQKSIAEIAKTLSSAALDPNTEVVIGCPAIYLMYARNLLPCELGL
AGQNAYKVAKGAFTGEISPAMLKDIGADWVILGHSERRAIFGESDALIAEKAEHALAEGL
KVIACIGETLEEREAGKTNEVVARQMCAYAQKIKDWKNVVVAYEPVWAIGTGQTATPDQA
QEVHAFLRQWLSDNISKEVSASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFV
DIINARQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaaagttctgcgtgggaggcaactggaagatgaacggcgaccagaagtccatc
gccgagatcgccaagaccctgagctcggccgccctcgaccccaacacggaggtggtcatc
ggctgcccggccatctacctgatgtacgcccgcaacctgctgccctgcgagctgggtctg
gccggccagaatgcctacaaggtggccaagggcgcattcaccggcgagatctcccctgcg
atgctgaaggacatcggcgccgactgggtgatcctgggacactcggagcgtcgcgccatc
ttcggcgaatcggacgccctgatcgccgagaaggccgagcacgccctggccgagggcctc
aaggtcatcgcctgcattggtgagaccctggaggagcgcgaggccggcaagaccaacgag
gtggtggcccgccaaatgtgcgcctacgcccagaagatcaaggactggaagaacgtggtg
gtggcctacgagcccgtctgggccattggcaccggccagaccgccacacccgatcaggct
caagaggtccacgccttcctgcgccagtggctgagcgacaacatctccaaggaggtgtcc
gccagcctgcgcatccagtacggtggatccgtgaccgccgccaacgccaaggagctggcc
aagaagcccgacatagatggcttcctggtcggaggcgcctccctgaagcccgagttcgtg
gacatcatcaacgcccggcagtaa

DBGET integrated database retrieval system