KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2999Help
Entry
Dmel_CG2999       CDS       T00030                                 

Gene name
unc-13
Definition
CG2999 gene product from transcript CG2999-RD
Orthology
K15293  
protein unc-13
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4:102E5-102F1
AA seq 2871 aa AA seqDB search
MTHYVRHDYFHNTQNGALSSDTSRISYSQISYETQPSREYFSESYALSNQGPEECSRVSH
LNSDTVLTTVDNSNNSYGYDYLECYGANIQCDPEEDSVDNWNENTSVVADQYGLGHNNLN
CTSSKLLPKLPNIENGRGSSNACAPQMDVKFNTKGMCIKIDHSYGVCMAKAHDFVGRLSP
SDYQNILGNNLNGYAGCAYSSTFLDNAMSSAPLRVLPQSPRCSSYLGRNIIGFNADAAQR
DGRGFDTDQTDAMGSESSTYEVYEKMQRPYTSMLPLDYSDYQEGCYNTDNLSTYSDTPPS
NNTQLKRQMQRKISLMMAMTTASVIASGEIRVPVHSKQSKKSTEIQTDSIIGNTISTNAA
ARDLDRCLATESCEVIVDTRDSGSVTSFPSSAVTAITKTRKLPKVLPTPLCKSSRHPITI
ATDALSSSYTSDPLPEKSHRPKQLPKLPISLPQSNDRASLNSNWATPPAPDALPFNSFDH
KSASSPTPTTTITKDTETTSYLVETDFIGARHNALYQYDSKEPNIVFSDKSVEAEHSPTW
TPLSPIQSKQSPCPPVALPSNIMQNVSLTCHLPEIEATRSDIEREPESSSIEPILEIEKL
ADPYSGPGSALFNISEYLKPYTLNKPILSEEKKNHIANAASTSTTTPLNITSDDEFSSYS
NKWTSTCVNFQPLDVESSLNISLKVNAGTNQAELLMTPLKSSTPLFISSNGTSDNFNLRK
SSPPDSAFTTTVNVNSFETVLVSGSQTASPSPSNLKSPPSIAPLLSYSDYMKQFELPELP
QPIMDLSENDTATQSDSFNVINNTLTNADNLNSYNQMDVESKSSLQLPSYSSESFDPCSV
PSFSIKNKEYKIVEKLDSLSNVESVESPKTLVSPVNPLNCSKLLPGTESIVSNDVAFDDT
FYDSFNVDIKELTAFVDHVAPEDGLYNFPNDKTSVEFSFDKTEDTIDMNQNLSSGECGYY
KPSQAQQKASVVASAASSVLDGISKGLKGGLDGVFSGVSSTVDVTQSNPSSKRGFSFNLA
SKIVPSVGGLLTSTSSTSIKQTGSETNPTLILISPENVSSRNSNYIPTTSPSCTQKNGEE
NLYSATVHNKSTKSNSYYNEVGEISSTLVRNVCDSYDNSYDEMILTNEMVNIGMLDSESE
FGLIENSYSYQVPDNEQIDSVNSYNNKTQNVTNNGIEKANTKNKPVPLHDPPTKKASTVG
MFGSILGKAAAAVQSATQAVNQSASSVASVVAQKPTIVPRTNNVLLLSSVCSPNEIKRNS
SSVEFDSEYGYQMPDVESLSSHYANTGGDYDNSNMKIHEFGTYADDRPYADYHTNGNQSQ
FKEEAVIPGEPEVINTNILPIGPQATGKKLPTVNGKSALLIKQMPTEVYDDESDTDELDV
SPSTGKVPSYSIYSEQEDYYMDLQQTTPSIQPNGFYEQVNNGYDYREDYFNEEDEYKYLE
QQREQEEHNQPKNKKYLKQAKISKIQPPSLDFIDVGQDDDFIYDNYHSEDDSGNYLEGSS
SGSVGPIEGSIIKVDSNIEASFASLNKKSDSFTPTNDSLQKHDTVIGESTTKLTRLRTEK
MCPDVDEEDENLSDHVSDLTDLSKLISQKKKTLLRGETEEVVGGHMQVLRQTEITARQRW
HWAYNKIIMQLNNGGGPGEVGLRTNGHPGDNPFYSNIDSMPDIRPRRKSIPLVSELTMAA
TKRNAGLTSAVPRATLNDEDLKMHVYKKALQALIYPISSTTPHNFLLWTATSPTYCYECE
GLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSIITAMKDRM
KQREREKPEIFELIRMTFGVDPDTHIDSLEQAEHATVEGTSKWSCKLTITVICAQGLIAK
DKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWDEDNDLKS
KLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEK
VAPYHVQYTCLHENLFHYLCEENTGMVKLPTQKGDDAWKLYFDEIPEEIVDEFSMRYGIE
NIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAASNFGKEK
FVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQELSSPPRA
STVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEAKRAPDDHEPKLDSVDFWHKLIA
LIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALEEHEQHRLCKSSAY
MNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHGAFKRDKK
DGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRRFAKTIVKVLIAYA
DIVKLEFPEHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKELQQNLNS
ALDDLASQFAISLEPRITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVEADEVLRP
LMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFKHLTDNAK
NLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDVALDTIKQ
YFHAGGNGLKKTFLEKSPELQSLRYALSLYTQMTDTLIKTFISSQVHEVDLENSEESVGE
ISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKFATK
SKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLKDISEKGS
VACWLPLMRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEIRQEPTMGT
NT seq 8616 nt NT seq  +upstreamnt  +downstreamnt
atgacgcactacgtgaggcatgattactttcataacacccaaaacggtgccttatcctct
gacaccagtcgaatatcttacagtcaaatttcttacgaaacacagcctagcagagaatat
ttcagtgagtcatatgctttaagcaatcaaggaccagaagaatgcagtcgcgtgagccac
ctaaacagtgatacagtacttacaaccgtggacaacagcaacaatagttatggctacgac
tatttagaatgttatggagctaatatccagtgtgatccggaagaggattctgttgacaat
tggaacgaaaacacttcagttgttgcagatcaatatgggttaggacataataatctaaat
tgtacctcatcgaaattattacctaagctgccaaacattgaaaatggaaggggttcttca
aacgcatgtgcccctcaaatggatgtaaagtttaacacaaaaggtatgtgcataaaaata
gaccacagctatggtgtctgcatggccaaagcacacgacttcgtcggacgtctttcgcct
agtgactaccagaatatccttggcaataatctcaatggatatgctggttgtgcctactcg
tcgacatttttagacaatgctatgtcatcggcaccattgcgggttttaccgcaatcaccg
cggtgtagctcttatttaggtcgaaatataattggatttaatgcagacgcggctcagagg
gatggacgcggcttcgacacagatcaaactgatgcgatgggttctgaatctagtacatat
gaggtttatgaaaaaatgcaaaggccatacacgtccatgttgccgttagattacagtgat
taccaagaaggttgttacaataccgacaatctttcaacatacagcgacacaccgccgagc
aataatacacaactaaagaggcaaatgcagaggaaaatttcgttaatgatggcgatgact
acagcttctgtgatagcatctggtgagattagagtcccagttcactcaaagcaatctaag
aaatctactgaaatccaaactgactctataataggaaacaccatcagcaccaatgccgct
gcaagagacttagacagatgtttggcgacggaatcttgtgaagtaattgtcgatacacgt
gactctggtagcgtcacaagtttcccgtcatctgctgtgactgcaataacaaagactaga
aaattgccaaaggttttaccaacgccactgtgtaaatcatctcgtcatccaatcaccata
gccaccgatgcattaagttcatcatatacttcagatcctttaccagagaagagtcatcgc
ccaaagcaactgccaaagctgcctatatcattaccccagtccaatgatcgtgcaagtctc
aattcgaattgggcgacccctcctgccccagatgcattaccatttaattcgttcgaccat
aaatcggcatcttctcctacgccaacaacaacaataacaaaagatacggaaaccacctca
tatctggttgaaacagattttattggagccaggcataatgccctttatcagtatgatagt
aaagaaccaaatatagtattttcggacaagtctgtcgaagcagaacactcgccaacgtgg
accccattatcgccaatacaatccaaacaaagtccttgtccgcctgtggcgctaccaagc
aatattatgcaaaatgtttctctaacatgtcacttacctgaaatcgaagcaacccgatcc
gatattgagcgagaaccagaaagctcttctatcgaaccaattctagaaattgaaaaatta
gccgatccatatagcgggcccggatcagccttatttaacatatctgagtatctgaagcct
tatacattaaataaacctattttgtccgaagaaaagaaaaaccatatcgccaatgctgcc
agtacgtcaaccacaacgccattgaatataacatcagatgacgaattctcttcatattct
aacaagtggacgagtacttgcgttaattttcaaccattagacgttgaatcaagcttaaat
atttcacttaaagtcaacgctggcacgaatcaggccgaattattaatgacaccattaaaa
agttccactcctcttttcatttcttctaatggcacatccgataattttaatttgaggaaa
agctctcctcccgacagcgcgttcaccaccacggttaacgtcaacagttttgaaacggta
ctagtatctggaagccaaactgcctcaccgtcgccgtcaaacttaaagtcaccaccatca
atagctccattattatcctactcggattatatgaaacaatttgagttaccagaattgccg
caacccattatggatctttcagaaaatgatactgctactcaaagcgattcctttaatgta
atcaataatactcttacgaacgctgacaatttaaattcctacaaccagatggatgtagaa
agcaaaagtagtctacagttaccttcttattccagtgaatcatttgatccgtgtagtgtg
cctagtttttcaattaagaacaaagaatataaaattgtcgaaaagctggacagtctatca
aatgttgaaagcgtagaatcaccgaaaaccttagtaagtccagtaaacccattgaattgc
tcaaaattattgccagggacggaatcaatagtgagtaatgatgtagcgttcgatgataca
ttttacgatagctttaatgttgacataaaagaactgaccgcatttgttgaccatgttgcc
ccagaggacggtttatacaatttcccaaacgataagacttcagttgaattcagttttgat
aagaccgaggatacaatagacatgaatcagaacttaagctcaggagaatgtggttattat
aagccatctcaggcacaacaaaaagctagtgtagtagcatccgcagcaagtagtgttctt
gacggaatttcaaagggcttaaaaggggggctggacggcgtttttagtggtgtcagttca
acagttgatgtcactcaatcaaatcccagttccaaaagaggttttagctttaacttagca
tcaaagattgtgccaagtgtcggtggattgctaactagtacaagttccacctctataaaa
caaacaggatcagaaactaatcctaccctaatattgatttcacctgaaaatgtttctagt
cgtaacagtaattatatacctacgacatctccatcttgtactcaaaaaaatggcgaggaa
aatttatattcggctacagtccacaataagtcaacgaaatcgaattcatactataatgaa
gtgggagaaattagttcgaccttagtcagaaatgtttgtgacagttacgataatagctat
gatgagatgattttaaccaacgaaatggtaaatatagggatgctcgacagtgaatctgag
tttggcttaatagaaaattcatattcgtatcaggtaccagacaatgagcaaatcgacagt
gttaactcgtataataataagacccaaaatgtaacaaataatggcatagaaaaggcaaat
acaaaaaataaaccagtgcctcttcatgaccctcctacgaaaaaagcaagtactgttggc
atgttcggatcaattttgggaaaagctgctgcagcagtgcaatcagcaacgcaagcagtc
aatcaaagtgcgtcgtcagtggcatcagtcgttgcacaaaagccaacaatcgtaccgaga
acgaacaacgtgcttttgttgtctagcgtatgctcacctaacgagattaaaagaaattca
agttcagtagaatttgattcagaatatggatatcaaatgcccgatgtagagtctctatca
agccattacgcaaatactggcggtgattatgataatagtaatatgaaaatacatgaattt
ggtacatatgcagatgatagaccatacgcagattatcatacgaatggcaatcaaagccaa
tttaaagaagaggcggtgattcctggggaacctgaagtaattaatacaaacatactcccg
attggcccgcaggccaccggcaaaaaacttcctaccgtcaatggtaaatcggcgttactt
attaaacagatgccgacggaggtatatgatgatgaatcagatacagatgaattagatgtc
agtccatcaaccggaaaagtacctagctatagcatttatagtgagcaggaagattactac
atggatcttcagcaaacgacaccgtcaattcagccaaacggtttttatgaacaagtcaat
aatggttatgactaccgagaggattactttaacgaggaggatgaatataagtatctcgag
cagcagagggagcaagaggaacataatcagccgaagaacaagaaatatctgaagcaggcc
aaaatatcaaaaatacaaccaccatcattagatttcattgacgtagggcaagacgatgac
tttatatacgacaactatcacagcgaagacgatagcggaaattacctagagggaagctcc
agtggaagcgttggtcctattgaagggtcaatcataaaggtggactcgaatatagaagct
tcgtttgcttcgctcaacaagaagagtgactctttcacaccgacaaacgattcccttcaa
aagcatgacactgttattggtgaatcaacaaccaaacttacgcgccttaggacagaaaaa
atgtgcccagacgtagacgaagaagatgaaaacctaagcgatcacgtttccgatcttact
gacttaagtaaactaatctcacaaaaaaaaaaaacgctcttgagaggagaaactgaagaa
gtcgtaggaggacacatgcaggtgttacgccaaacggaaatcacagctcggcaacgatgg
cattgggcttacaataaaataatcatgcagcttaataatggaggtggtcctggagaagtg
ggattacgtacaaatggtcatcccggtgacaatccattctatagcaatattgacagtatg
ccggacataaggcctcgaagaaaatccattcctcttgtgtctgagctgacaatggccgct
acaaaacgaaatgctggactcacatctgctgttccacgtgcaacgctgaatgacgaagat
ctgaaaatgcacgtgtacaaaaaagctctacaagccctgatatatcctatatcctcaaca
acgccccacaattttttgttatggactgctacgtcaccaacgtactgctacgagtgtgag
ggtcttttgtgggggatagcacgacaaggggtccgttgcactgagtgcggtgtaaagtgt
catgaaaaatgtaaggaccttctgaatgcggactgcctgcagcgtgctgccgaaaaaagc
tcaaagcacggtgcggaagacaaggctaactcgattattacagcgatgaaagatcgtatg
aagcaacgtgaacgagagaagcctgaaatttttgagttgattaggatgacattcggtgtg
gatcccgatacacacatagattcattagagcaggctgagcacgcaacagttgagggaaca
tctaagtggtcatgcaaactaacaattacagtgatttgtgctcaaggcctgatagcgaag
gataaaagcggtaccagtgatccatatgtgacggtgcaagttagcaaggtgaaaaaacga
acgcgaacaatgccgcaggaacttaatcctgtgtggaacgagaagtttcacttcgagtgc
cacaactcctccgaccgcattaaggttcgtgtttgggacgaagacaatgacctaaagtcg
aaactgcgccagaagttaactcgagagtcggacgactttttgggacaaacaattatcgag
gttcgtactctttccggtgaaatggatgtatggtacaacctggaaaagcgcacagataaa
tcggccgtatcaggcgcgatacggcttcacatatctgttgaaataaagggcgaggaaaaa
gtagctccttaccacgtacaatatacctgtttacacgagaacctcttccattatctttgc
gaagaaaataccggaatggtcaagttgccaactcaaaaaggggacgatgcttggaagttg
tattttgatgaaatacccgaagagattgtcgacgagttttcgatgcgttatggaattgag
aatatttatcaagctatgacacatttccactgcttgtctgctaaatacctatgtcctggg
gtaccagctgtaatgagtacccttttggcaaacataaatgcttattatgctcatacgact
gcttcgtcagctgtatcggccagtgatagatttgctgccagcaattttgggaaagaaaaa
tttgttaagttgctggaccagttgcataactcactgaggatcgatttgtcaatgtacaga
aataactttcctgcatcgagtccagaaaagctaatggatctaaaatctacagttgattta
ttgaccagcataacatttttccgcatgaaggtacaagagctatctagcccgccgagagca
agtacagtagtcaaggattgtgttaaagcatgccttagatccacttatcaattcttattt
gaaaattgttatgaactgtacaacagagaatttcaggttgatcccaacgaagcaaaacgt
gcaccagatgatcatgaacccaagcttgatagcgtcgacttttggcataagctaatagct
ttaatcgtatcggtaatagatgaagacaaaaacagttacggaaccgttttaaatcaattt
ccgcaagagctaaatattggacagttatcagcatcttcaatgtggcatctctttgctgtg
gacatgaagtacgcgctcgaggagcatgagcaacatcgtctttgcaagtcatcggcttat
atgaatcttcactttcgagttaagtggctatatagtaactacgtcaaagaggtgcctccc
tacaaaggagcggttcccgattacccagcatggttcgagccttttgtgatgcagtggcta
aatgaaaatgacgacgtgtcattggaataccttcatggcgcatttaagagggataaaaaa
gacgggtttcaaaagagcagcgagcacgcgctcttttcaaattctgtagtcgacgttttt
acgcaattgacgcagtgtttcgatgttgttagcaaactcgagtgtcctgatccagaaatt
tggaaacgttacatgagacgttttgctaaaacaatcgtaaaagtgctaatagcctatgcg
gatattgtgaaacttgagtttccagagcatatgaaggatgaaagaattgcttgcatactt
atgaacaacattcagcaactaagggtgcagctagaaaaaatgtttgagtctatgggtggg
gataagctagaggaggatgcagccaatattttgaaagaacttcagcaaaatcttaactct
gcgttggacgacttagcttcacaattcgctatcagtttggagccacgaataactcaatca
gtgcgagaacttggagacatgctgctttctattaaaggaggcagtggaacccttgctgct
ggtaatcttgcagctcaaaggaacgcggtcgccgttgaggccgatgaagttttaaggccg
cttatggatttacttgatggctctttaactctctatgcgcaatcatgtgaaaaaaccgtg
ttgaagaggttactaaaggagttatggaagatcgtaatgcgaatattagagaaaacaatt
gttttaccacctatgactgataaaactatgatgtttaaacaccttactgacaatgcaaaa
aacttggcatcgaatgcaaaaattgaagacatgggtcgtttgttcaagtcacatatggca
ggaaagcaggatgttaagagtgctctgagcggggtaatggacatatcaaaagaagtagaa
aaaaacttgtcacccaagcaatgcgcagtgcttgatgttgccttagatacaataaaacaa
tactttcacgcgggtggcaatggactgaaaaagacctttctcgaaaagtcgcccgagctt
cagagtttacgttacgcactcagtttatatacacaaatgaccgacacactaatcaaaacc
tttatatctagccaagttcacgaggtcgatctagaaaactcagaggaaagtgttggggaa
atatccgtgcaaatagacttattttcccatcccggcaccggtgaacataaagtaaacgtg
aaagttgttgctgctaatgaccttaaatggcaaataccatcgggtatgttcagaccattt
gttgacattaatttaataggaccgcacctgcaagaaaaaaaaaggaagttcgctacaaag
tcgaagtctaacaactggtcgcctaaatacaacgaatctttcagcttcaccattggaaat
gaggagcagctggacttctttgaattgcacatttgcgttaaggactattgttttgctcgt
gatgaccgacttgtgggcgtggctgtaattccattaaaagatatatcggaaaagggatcg
gtcgcatgctggttacccttaatgagacgaattgaaatggacgaaacgggctggaccatt
ttaagaattttgtcacagcgaaataatgatgaagtggccaaggaatttgtcaagcttaaa
tcggaaatacggcaggagccaaccatgggtacataa

DBGET integrated database retrieval system