KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3936Help
Entry
Dmel_CG3936       CDS       T00030                                 

Gene name
N
Definition
Notch
Orthology
K02599  
Notch
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dmel_CG3936 (N)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG3936 (N)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
X:3C7-3C9; X:1-3.0 cM
AA seq 2703 aa AA seqDB search
MQSQRSRRRSRAPNTWICFWINKMHAVASLPASLPLLLLTLAFANLPNTVRGTDTALVAA
SCTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNSMRCQNGGTCQVTFRNGRP
GISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNL
CASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGSYQ
CMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGH
LCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCIC
VNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHA
DAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGF
TGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGT
CHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCE
ININDCDSNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGS
YYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECI
SSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCP
PGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGN
GGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYT
GRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGT
CLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQ
TNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNN
EYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISC
QDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRD
LIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINK
DDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSNAGTLDCVQLVNN
YHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQDCD
SNPCRVGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNPCAQGAACEDLLGDYECL
CPSKWKGKRCDIYDANYPGWNGGSGSGNDRYAADLEQQRAMCDKRGCTEKQGNGICDSDC
NTYACNFDGNDCSLGINPWANCTANECWNKFKNGKCNEECNNAACHYDGHDCERKLKSCD
SLFDAYCQKHYGDGFCDYGCNNAECSWDGLDCENKTQSPVLAEGAMSVVMLMNVEAFREI
QAQFLRNMSHMLRTTVRLKKDALGHDIIINWKDNVRVPEIEDTDFARKNKILYTQQVHQT
GIQIYLEIDNRKCTECFTHAVEAAEFLAATAAKHQLRNDFQIHSVRGIKNPGDEDNGEPP
ANVKYVITGIILVIIALAFFGMVLSTQRKRAHGVTWFPEGFRAPAAVMSRRRRDPHGQEM
RNLNKQVAMQSQGVGQPGAHWSDDESDMPLPKRQRSDPVSGVGLGNNGGYASDHTMVSEY
EEADQRVWSQAHLDVVDVRAIMTPPAHQDGGKHDVDARGPCGLTPLMIAAVRGGGLDTGE
DIENNEDSTAQVISDLLAQGAELNATMDKTGETSLHLAARFARADAAKRLLDAGADANCQ
DNTGRTPLHAAVAADAMGVFQILLRNRATNLNARMHDGTTPLILAARLAIEGMVEDLITA
DADINAADNSGKTALHWAAAVNNTEAVNILLMHHANRDAQDDKDETPLFLAAREGSYEAC
KALLDNFANREITDHMDRLPRDVASERLHHDIVRLLDEHVPRSPQMLSMTPQAMIGSPPP
GQQQPQLITQPTVISAGNGGNNGNGNASGKQSNQTAKQKAAKKAKLIEGSPDNGLDATGS
LRRKASSKKTSAASKKAANLNGLNPGQLTGGVSGVPGVPPTNSAAQAAAAAAAAVAAMSH
ELEGSPVGVGMGGNLPSPYDTSSMYSNAMAAPLANGNPNTGAKQPPSYEDCIKNAQSMQS
LQGNGLDMIKLDNYAYSMGSPFQQELLNGQGLGMNGNGQRNGVGPGVLPGGLCGMGGLSG
AGNGNSHEQGLSPPYSNQSPPHSVQSSLALSPHAYLGSPSPAKSRPSLPTSPTHIQAMRH
ATQQKQFGGSNLNSLLGGANGGGVVGGGGGGGGGVGQGPQNSPVSLGIISPTGSDMGIML
APPQSSKNSAIMQTISPQQQQQQQQQQQQQHQQQQQQQQQQQQQQQQQLGGLEFGSAGLD
LNGFCGSPDSFHSGQMNPPSIQSSMSGSSPSTNMLSPSSQHNQQAFYQYLTPSSQHSGGH
TPQHLVQTLDSYPTPSPESPGHWSSSSPRSNSDWSEGVQSPAANNLYISGGHQANKGSEA
IYI
NT seq 8112 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcgcagcgcagccgacgtcgcagtcgcgcaccaaacacttggatttgtttttgg
attaacaaaatgcacgccgttgcgtcgctgccggcgtcgctgcctctgctgctgttgacg
ctggcgtttgcgaatttgccaaacaccgttcgcggaactgataccgcgttggtggccgct
tcctgcacaagtgtcggttgccagaatggcggcacatgcgttacacaactcaatggcaaa
acctactgcgcatgcgattcgcactatgtcggcgactactgtgaacaccgcaatccgtgc
aattcgatgcgttgccaaaatggtggcacctgtcaggtgacctttcgcaacggccgtccg
ggcatctcgtgcaagtgtcctttgggcttcgacgagtccctgtgcgaaattgcggtaccg
aatgcctgcgatcatgtgacctgcctcaatggaggcacctgtcagctaaagacactggag
gagtacacgtgtgcgtgtgccaatggctatacaggtgaacgatgcgagacgaagaatctg
tgcgcaagttctccctgccggaatggagccacctgcaccgctttggccggaagcagcagc
ttcacctgctcctgtccgccgggcttcaccggtgacacctgttcctatgacatcgaggag
tgccagtcgaatccgtgcaaatacggcggcacatgtgtcaacacccacggatcttaccag
tgcatgtgtcccacgggctacacgggaaaggattgcgacaccaagtacaagccctgctcg
ccatcgccgtgccagaatggcggaatttgccggtcgaacggtctgtcctacgagtgcaag
tgccccaaaggtttcgagggcaagaactgcgaacagaactacgacgattgcctgggacat
ctttgccagaacggaggaacctgcatcgatggcatctcggactacacctgccgctgtcca
ccgaacttcacgggcagattctgccaggacgatgtggacgagtgcgcccaacgggatcat
ccggtgtgccagaacggagccacctgtacaaacactcacggatcgtacagctgcatctgc
gtgaatggctgggcgggcttggactgcagcaacaacacggatgactgcaaacaggcggcc
tgtttctacggagccacgtgcatcgatggcgttggcagcttctattgccagtgtacgaag
ggcaagacgggtctgttgtgccacctggacgatgcctgtacctcgaatccctgccatgcg
gacgccatttgtgacacgagtccgataaacggctcctatgcctgttcctgtgccaccggc
tacaagggcgtggattgttcagaggacatagatgaatgcgatcagggatcaccgtgcgaa
cacaatggcatatgcgtgaacacaccgggcagctacagatgcaattgctcccagggcttt
acgggtccgcgctgcgagacgaacatcaatgagtgcgaatcgcatccatgccagaacgag
ggatcttgcctggatgatccgggaacgttccgatgcgtctgtatgccaggattcacgggc
acacagtgcgaaatcgacattgacgaatgccaatcgaatccctgcttgaacgatggaact
tgccacgacaagatcaatggctttaaatgcagttgtgccctgggctttacgggcgcacga
tgtcaaatcaatatagacgactgtcagtcgcaaccatgccggaatcgtggcatctgtcac
gactctatagcgggctacagctgcgaatgtccgccgggatatacgggcaccagttgcgag
atcaatatcaacgattgcgattcgaatccctgccatcggggcaagtgcatcgacgatgtg
aacagtttcaagtgcctctgtgatcccggctacacgggctacatatgccagaagcagatc
aacgaatgcgaatcgaatccgtgccagttcgatggccattgccaggatcgtgtgggcagc
tactattgtcagtgccaggcgggaaccagtggcaagaattgcgaggtcaatgtgaacgaa
tgccacagtaatccctgcaacaatggtgccacctgcatcgatggcatcaattcgtacaag
tgccagtgtgtgcccggttttacgggtcagcactgcgagaagaacgtcgacgagtgcatt
agcagtccgtgtgccaacaatggtgtctgcatagatcaggtgaatggctacaagtgcgag
tgtccgcgtggattctacgatgcccattgcctgagcgatgtggacgagtgcgcatcgaat
ccgtgcgtgaacgagggacgttgcgaggatggaatcaatgagttcatctgccactgtccg
ccaggatacacgggcaagcgttgtgagctggacatagacgagtgcagcagcaatccctgc
cagcatggtggcacctgttatgataagctcaacgccttcagttgccaatgcatgccgggc
tatacgggccaaaagtgcgaaacgaatattgacgactgtgtgaccaatccgtgcggaaat
ggaggcacctgcattgacaaggtcaacggctacaagtgcgtctgcaaagtgcccttcacg
ggcagggattgtgaaagcaaaatggatccctgcgccagcaatcgttgcaaaaacgaggcg
aaatgcacgccaagctcgaatttcctggacttctcctgcacctgcaaactgggctatacg
ggtcgctattgcgatgaggacatagacgaatgctcactgagttcaccctgtcggaatgga
gctagctgtttgaatgttcccggatcgtataggtgcctctgcaccaagggctatgagggc
agagattgcgccatcaatacggacgattgtgcctcgtttccgtgccagaacggtggaacc
tgtctggatgggatcggtgactatagctgcctgtgcgtggatggcttcgatggcaagcac
tgcgagacggacatcaatgagtgcttgagtcagccgtgccagaatggagccacgtgtagt
cagtatgtgaatagctatacctgcacctgtccactcggattctccggcatcaattgtcag
acgaacgatgaggattgcacggagagctcgtgcttaaacggtggcagttgcatcgatggc
atcaatggctacaactgtagctgtttggctggatattccggtgccaattgtcagtacaag
ttgaataagtgcgattcgaatccctgtttgaacggagccacctgccacgagcaaaacaac
gagtacacatgccattgtcccagtggctttacgggcaaacagtgttccgaatatgtggat
tggtgtggtcaatcgccgtgcgagaatggagcgacctgtagccagatgaagcatcagttt
agctgcaaatgctcggcaggatggacgggtaagctgtgcgatgttcagacgatttcgtgt
caggatgcagcagatcggaagggtctgagcctgcggcagttgtgcaacaatggcacgtgc
aaggattatggaaatagtcatgtgtgctactgctcccagggatacgcgggtagctattgc
caaaaggagatcgacgagtgccaatcgcaaccgtgccagaatggtggaacgtgccgagat
ctcatcggagcctacgaatgccagtgtcgccagggatttcagggtcagaattgcgaactg
aacatcgatgactgtgcaccgaatccctgccagaatggcggcacttgccacgaccgtgtg
atgaactttagctgcagctgtccaccgggaacgatgggcatcatatgcgagatcaacaag
gatgattgcaaaccgggagcatgccacaacaacggcagctgcatcgatcgcgttggaggc
ttcgagtgcgtctgtcagcccggttttgtgggtgcccgctgcgagggcgacatcaacgag
tgcctaagcaatccctgttcgaatgccggcacactggactgcgtccagttggtcaataac
tatcactgcaactgtcgacctggacatatgggtcggcactgtgagcacaaggtggacttt
tgtgcccagagtccgtgccagaatggtggcaattgtaatatccgacagagtggccaccac
tgcatctgtaataatggattctacggtaagaactgtgagctgagtggtcaggattgtgat
tcgaatccctgccgtgtgggtaactgtgttgtcgcggacgagggattcggctatagatgc
gagtgtccaaggggcacactgggtgagcactgcgagattgatacgctagacgaatgttcg
ccgaatccctgtgcccagggagctgcctgcgaggatttgctcggtgattacgaatgcctc
tgtccgagcaaatggaaaggcaaacgctgcgatatctatgatgccaactatccgggatgg
aatggcggttcgggatccggaaatgatcgctatgccgctgatttggagcaacaacgtgcc
atgtgcgataagcgaggttgcaccgaaaagcagggcaacggcatttgcgattccgattgc
aatacgtatgcctgcaactttgatggaaacgattgctcactgggcatcaatccgtgggcc
aattgcacggccaacgagtgctggaacaaattcaagaacggcaaatgcaacgaggagtgc
aacaatgctgcctgccactacgatggtcacgattgcgaacggaaattgaagagttgcgat
agccttttcgatgcctactgccagaagcattacggcgatggtttctgcgactatggatgc
aataatgcggaatgcagttgggacggactcgactgtgagaacaagacccagtcaccggtt
ttggccgagggtgccatgtccgtggtgatgctaatgaatgtggaggcattccgcgagatt
caggctcagttccttaggaatatgagccacatgctgcggacaacggtgcggttgaagaag
gacgctcttggtcatgacatcattatcaattggaaggacaatgtgcgcgtgccggagatc
gaggatacggactttgcgagaaaaaacaagattctgtacacccaacaggtccatcagacg
ggcattcaaatctatttggagattgacaatcgcaaatgcaccgaatgctttacgcacgcc
gttgaggcagccgaatttctggctgccacggcggccaaacatcagctgcggaacgatttt
cagatacacagtgttaggggcatcaagaatcccggcgatgaggacaatggtgagccgccg
gcgaatgtgaaatacgtaattactggcattatactggtcatcattgcattggccttcttt
ggcatggtcttgagtacgcaaagaaagcgggcacatggcgtcacctggttcccggaggga
ttccgtgcaccggcggcggttatgtcgcgacgtcgacgtgatccacacggccaagagatg
cggaatctcaacaagcaggtggccatgcaatcgcagggtgttggccagccaggtgctcat
tggtccgacgatgaatcggatatgccgttgcccaagcgacagcgcagtgatcccgtttcc
ggtgtcggtctgggcaacaatggtggctatgccagtgatcatacaatggtcagcgaatat
gaggaggctgatcagcgggtctggtcgcaggcccatctggatgtggtcgatgtgcgggcc
ataatgacaccgccggcgcatcaggatggtggcaagcacgatgtggatgcacgtggacct
tgcggactgactccgctaatgattgctgccgtacgaggcggtggcctggacactggcgag
gatatcgagaacaatgaggacagtactgcccaggtgatatcggatctattggcacaggga
gccgagttaaatgccacaatggataaaacgggcgagacatcattgcatttggcagcacgt
tttgctcgagcagatgccgccaagagattattggacgccggtgcggatgccaattgtcag
gataacacgggcaggacaccgctgcacgctgctgtggccgccgatgccatgggtgtattt
cagatattgcttaggaatagggctaccaatctaaatgctagaatgcatgacggcacaacg
ccactaatactggccgctcgtctagccatcgagggcatggtggaggatttgatcacagcc
gatgcggatattaatgcagcggataattccggcaagaccgctctccattgggcagcggcg
gttaacaataccgaagcggtgaacattctgctaatgcatcatgccaatcgcgatgcccag
gacgataaggatgagacaccgctgtttctggccgcacgcgagggtagctatgaggcgtgc
aaggcgctgttggataattttgccaatcgcgagattaccgatcacatggatcgattgcca
cgcgatgtggccagcgagcgactgcatcacgatattgtcaggctgctggacgagcatgtg
ccgcgatctccgcaaatgctgagcatgacaccgcaggcaatgatcggatccccgccgccg
ggtcaacagcagccgcagttgatcacacagccgacggtcatttccgccggaaatggtggc
aacaatggcaatggcaatgccagcggaaagcagagcaaccaaacggccaaacagaaggcg
gccaagaaggccaaactaatcgagggcagtccggacaatgggctggatgccacgggcagt
ttgcgacgcaaggcaagttcaaaaaagacaagtgcggcctcaaaaaaggccgccaacttg
aatggcctaaatccgggccagctgacggggggagtgtcgggcgtgccgggtgtaccgcca
acgaattcagcggcacaagcagctgcagcggcagcggcagccgtggcggccatgtcccac
gaactggagggttcgccggtgggcgtgggcatgggcgggaatctgcccagtccgtacgac
accagttcgatgtactcgaatgcgatggccgcaccgctggcgaacggcaatccgaacacg
ggcgccaagcagccgccgagctatgaggattgcatcaagaatgcgcaatcgatgcaatcg
ctgcagggcaatggtctggatatgatcaagctggataattatgcctactcgatgggctcg
ccatttcagcaggagctgctcaatggccaaggactcgggatgaatggtaatggccagcga
aatggagtcggtcccggcgttctgcccggcggcctatgcggaatgggcggtctgagtgga
gccggcaatggaaatagccacgaacagggactgagtccgccgtactcgaatcagtcgccg
ccgcattcggtgcagagcagcctggcgctatcgccccacgcctacttgggctcgccatcg
ccggccaagtcgcgacccagtctacccacctcgcccacccacattcaggcgatgaggcat
gccacacagcagaagcaattcggtggcagtaatctgaatagtttgctgggcggtgccaat
ggcgggggcgtggtcggcggaggaggaggtggtggtggtggtgttggccaggggccacaa
aactcacccgtaagcttgggaatcatctcgccgacgggcagcgatatgggcatcatgctc
gccccgccccaatcctcgaagaatagtgcaataatgcaaacgatatcaccccagcaacag
cagcagcagcagcaacagcaacagcagcaacatcagcagcagcaacagcagcagcaacag
cagcagcagcaacagcagcagcaactcggaggcctggagttcggttcagcgggcttggac
ctgaatggattttgtggatctccggactcatttcactcgggtcaaatgaatccgccctcg
atacaaagttcaatgtccggctcatcgccgtcgaccaatatgttgtcgccgtcgtcgcag
cacaatcagcaggccttctaccagtacctaacgccttcgagccaacattccggcggccat
acgccgcagcatttggtccaaacgttggatagctatccgacgccctcgccggagtcacct
ggccactggtcctcctcgtcgccgcgatcgaattccgattggagcgagggcgttcagtcg
ccggcggcaaataatctttacatatccggtggccatcaggctaacaagggttccgaggcc
atctacatttga

DBGET integrated database retrieval system