KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4001Help
Entry
Dmel_CG4001       CDS       T00030                                 

Gene name
Pfk
Definition
Phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dme01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dme01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dme00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dme00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dme00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dme00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:46E8-46F1; 2R:2-85.2 cM
AA seq 950 aa AA seqDB search
MHSIKFRVFTKLKPIFLEINGRIPICRHFHGPTTFRLEISNKTPPIRQKLTFPNIGIQCT
RSHHLCCPRDISGNTLLSVKFNCKRHCIKLRSDSGDQKNDSPGEKNIQKDKSAQRCGKPI
NNLHNGFLNAVNYSEKNAVKKKKSAPKRKCGKSVDELRKCLRTMQDVIDFVHPVKPFKDK
GLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGMVDGGDCIQEANWASVSSI
IHRGGTIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLL
DELVKNKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTA
YSHQRTFIMEVMGRHCGYLSVVAGIISEADYVFLPESPPQADWPDRLVLKLEQERSAGQR
LNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGHVQRGGNPSAFDRILACRM
GAEATLALMEATKDSVPVVISLDGNQAVRVPLMECVERTQAVAKAMAEKRWADAVKLRGR
SFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYR
GDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLPEGKFKEIAARLKEFK
IQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLGCDTGLNEI
TEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDV
YHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNILGHMQQGGSPT
PFDRNMGTKMAAKCVDWLAAQIKANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDLIA
ETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEEECDTDAVA
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaataaaatttcgagtatttaccaaattaaaacctatatttttggaaatcaat
ggacggatacccatttgccgccattttcatggtcctacaacatttcgcttagaaatctca
aacaaaacacctccgattaggcaaaagctcacatttccaaacatcggcatccaatgcaca
cgaagtcatcatttgtgttgtcctcgagatatttcaggaaatactcttttaagtgtaaaa
tttaattgcaaacgacattgtataaagttgcgcagtgattctggtgatcaaaagaatgat
agtcctggtgaaaaaaacatacaaaaagacaagtctgcgcaacgatgtggaaaaccaata
aacaatctgcacaacggatttcttaatgctgtgaactattctgaaaagaatgcggtgaaa
aagaaaaagagtgcaccaaaaaggaaatgtggcaaatcggtggatgagctgcgaaagtgt
ttaagaaccatgcaggatgttattgattttgtacatccagtcaagccttttaaggacaaa
ggactggcggtcttcaccagcggcggggattcccagggcatgaatgccgccgtgcgagcc
tgtgtccgtatggccatctatttgggctgcaaggtctacttcattcgtgaaggctaccag
ggcatggtggatggtggcgactgcatccaggaagccaactgggcctcagtctcatccatt
atccatcgtggtggcaccatcattggctccgcccgttgccaggacttccgtgagcgtcag
ggtcgcttgaaagccgctaacaacctgattcagcgaggaatcaccaatctggtggtcatt
ggaggcgatggctccctcacgggcgccaatctgttccgtcaggagtggtccagcctgttg
gacgagctggtcaagaacaagaccattaccaccgagcagcaggagaagttcaatgtcctg
cacatcgttggattggttggctccatcgacaacgatttctgtggcactgacatgaccatc
ggcacggacacggcactacatcgcatcatcgaggcaatcgatgccatctccagtacagcc
tactcccatcagcgcaccttcatcatggaggtcatgggtcgtcattgcggctatctttcg
gtggtagctggcattatctccgaggcagactacgtctttctgcccgagtctcctccgcag
gccgattggcccgatcgacttgtccttaaattggaacaggagcgatctgctggccagcgt
ctgaacatcgtgattgtggccgagggagccatggatcgcgagggtcatcccatcacagcc
gaggatgtaaagaaggtgatcgacgagcgtctgaagcacgatgcccgcatcactgtcttg
ggtcacgtgcagcgcggtggcaatcccagtgccttcgatcgtattttggcttgccgcatg
ggagctgaggccactttggccctgatggaggccaccaaggactcggtgccagtggtcatc
tctctggacggcaaccaggcggttcgcgtgccgctgatggagtgcgtagagcgcacccag
gctgtggccaaggccatggcggagaaacgctgggcggatgccgtcaagctgcgcggacgc
tccttcgagcggaatctggagacctacaagatgctgacgcgcttgaagccgcccaaggag
aacttcgacgccgatggcaagggaatcgaaggataccgcctagctgtgatgcatattggt
gctccggcttgcggtatgaatgccgctgtgcgcagcttcgtgcgcaatgccatctaccgc
ggtgatgtggtttatggaatcaacgacggtgtcgagggtctgattgccggaaatgtccgc
gagctgggctggtcggatgtctcaggatgggttggtcagggtggcgcctacttgggtacc
aaacgcacactgcctgagggcaagttcaaggagatcgccgctcgtctcaaggagtttaag
atccagggtctcctgatcattggtggctttgagagttaccatgccgccggacagatcgcc
gatcagcgggacaactacccacagttctgcatccccattgtggttattccatcgacgatt
tcgaacaatgtgcccggcacagaattttctctgggatgcgacaccggtttaaatgagatt
acggagatttgcgaccgtatccgtcagtcggcacagggaaccaagcgccgagtgttcgtc
attgagacgatgggtggctactgtggctatttggccaccttggccggcttggccggcgga
gctgatgccgcctacatctacgaggagaagttctccatcaaagacctgcagcaggatgtc
taccacatggcctccaagatggccgagggcgtctcccgcggtctaatcctgcgaaacgag
aaggctagcgagaactacagcacggacttcatttaccgcctgtactcggaggagggcaag
ggcctcttcacctgccgtatgaacatcctgggtcacatgcagcagggcggctcacccact
cccttcgaccgcaacatgggcaccaaaatggccgccaagtgtgtcgactggctggccgcc
cagatcaaggcgaacatcgacgccaacggcgtagtcaactgcaagtccccggacaccgcc
acgctgctgggaatcgtgtcgcggcagtaccgcttctcaccgctggtcgacctcattgca
gagacgaacttcgatcaacgcatcccgaagaagcagtggtggctgcgcctgcgtcccctg
ctgcgcatcctggccaagcacgattccgcctacgaggaggagggtatgtacatcaccgtc
gaggaggagtgtgacactgacgccgtcgcctaa

DBGET integrated database retrieval system