KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4001Help
Entry
Dmel_CG4001       CDS       T00030                                 

Gene name
Pfk
Definition
(RefSeq) Phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dmel_CG4001 (Pfk)
   01230 Biosynthesis of amino acids
    Dmel_CG4001 (Pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG4001 (Pfk)
   00030 Pentose phosphate pathway
    Dmel_CG4001 (Pfk)
   00051 Fructose and mannose metabolism
    Dmel_CG4001 (Pfk)
   00052 Galactose metabolism
    Dmel_CG4001 (Pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dmel_CG4001 (Pfk)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dmel_CG4001 (Pfk)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dmel_CG4001 (Pfk)
Messenger RNA biogenesis [BR:dme03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dmel_CG4001 (Pfk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:46E8-46F1; 2R:2-85.2 cM
AA seq 788 aa AA seqDB search
MNSEINQRFLARGSQKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGM
VDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGG
DGSLTGANLFRQEWSSLLDELVKNKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGT
DTALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLALVGGLACEADFIFIPEMPPKVD
WPDRLCSQLAQERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGH
VQRGGNPSAFDRILACRMGAEATLALMEATKDSVPVVISLDGNQAVRVPLMECVERTQAV
AKAMAEKRWADAVKLRGRSFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAP
ACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKR
TLPEGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISN
NVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGAD
AAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGL
FTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLAAQIKANIDANGVVNCKSPDTATL
LGIVSRQYRFSPLVDLIAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE
ECDTDAVA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgaattccgagattaatcaacgattcctggcccgcggctcgcagaaggacaaaggactg
gcggtcttcaccagcggcggggattcccagggcatgaatgccgccgtgcgagcctgtgtc
cgtatggccatctatttgggctgcaaggtctacttcattcgtgaaggctaccagggcatg
gtggatggtggcgactgcatccaggaagccaactgggcctcagtctcatccattatccat
cgtggtggcaccatcattggctccgcccgttgccaggacttccgtgagcgtcagggtcgc
ttgaaagccgctaacaacctgattcagcgaggaatcaccaatctggtggtcattggaggc
gatggctccctcacgggcgccaatctgttccgtcaggagtggtccagcctgttggacgag
ctggtcaagaacaagaccattaccaccgagcagcaggagaagttcaatgtcctgcacatc
gttggattggttggctccatcgacaacgatttctgtggcactgacatgaccatcggcacg
gacacggcactacatcgcatcatcgaggcaatcgatgccatctccagtacagcctactcc
catcagcgcaccttcatcatggaggtcatgggtcgtcattgcggctatttagctcttgtg
ggtggactggcgtgcgaggcggatttcatattcattcccgaaatgccgcccaaggtcgat
tggccagacaggctctgctctcagctggcccaggagcgatctgctggccagcgtctgaac
atcgtgattgtggccgagggagccatggatcgcgagggtcatcccatcacagccgaggat
gtaaagaaggtgatcgacgagcgtctgaagcacgatgcccgcatcactgtcttgggtcac
gtgcagcgcggtggcaatcccagtgccttcgatcgtattttggcttgccgcatgggagct
gaggccactttggccctgatggaggccaccaaggactcggtgccagtggtcatctctctg
gacggcaaccaggcggttcgcgtgccgctgatggagtgcgtagagcgcacccaggctgtg
gccaaggccatggcggagaaacgctgggcggatgccgtcaagctgcgcggacgctccttc
gagcggaatctggagacctacaagatgctgacgcgcttgaagccgcccaaggagaacttc
gacgccgatggcaagggaatcgaaggataccgcctagctgtgatgcatattggtgctccg
gcttgcggtatgaatgccgctgtgcgcagcttcgtgcgcaatgccatctaccgcggtgat
gtggtttatggaatcaacgacggtgtcgagggtctgattgccggaaatgtccgcgagctg
ggctggtcggatgtctcaggatgggttggtcagggtggcgcctacttgggtaccaaacgc
acactgcctgagggcaagttcaaggagatcgccgctcgtctcaaggagtttaagatccag
ggtctcctgatcattggtggctttgagagttaccatgccgccggacagatcgccgatcag
cgggacaactacccacagttctgcatccccattgtggttattccatcgacgatttcgaac
aatgtgcccggcacagaattttctctgggatgcgacaccggtttaaatgagattacggag
atttgcgaccgtatccgtcagtcggcacagggaaccaagcgccgagtgttcgtcattgag
acgatgggtggctactgtggctatttggccaccttggccggcttggccggcggagctgat
gccgcctacatctacgaggagaagttctccatcaaagacctgcagcaggatgtctaccac
atggcctccaagatggccgagggcgtctcccgcggtctaatcctgcgaaacgagaaggct
agcgagaactacagcacggacttcatttaccgcctgtactcggaggagggcaagggcctc
ttcacctgccgtatgaacatcctgggtcacatgcagcagggcggctcacccactcccttc
gaccgcaacatgggcaccaaaatggccgccaagtgtgtcgactggctggccgcccagatc
aaggcgaacatcgacgccaacggcgtagtcaactgcaagtccccggacaccgccacgctg
ctgggaatcgtgtcgcggcagtaccgcttctcaccgctggtcgacctcattgcagagacg
aacttcgatcaacgcatcccgaagaagcagtggtggctgcgcctgcgtcccctgctgcgc
atcctggccaagcacgattccgcctacgaggaggagggtatgtacatcaccgtcgaggag
gagtgtgacactgacgccgtcgcctaa

DBGET integrated database retrieval system