KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4389Help
Entry
Dmel_CG4389       CDS       T00030                                 

Gene name
Mtpalpha
Definition
Mitochondrial trifunctional protein alpha subunit (EC:1.1.1.211 1.1.1.35 4.2.1.17 4.2.1.74)
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:dme01200]
Metabolism; Overview; Fatty acid metabolism [PATH:dme01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dme00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dme00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dme00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:dme00071]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dme01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:dme00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dme00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:dme00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:dme00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:30B12-30B12
AA seq 783 aa AA seqDB search
MSATRFLSAVGQISRQQLLQNKCTRALPISAQLLQRRRLMSTNPAPVANKHLHTKVVNGV
LVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADIGMLEA
CQTAEEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKL
GLPEVMLGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPGL
QPAEQNTIEYLEKTAVQVANDLASGKLRVNREKSGLVSKIQSFVMDTDFVKNKIFDTARK
QVLKASNGLYPAPLKILDVIRAGVDKGTDAGYEAERKGFGELSATPESKGLIALFRGQTE
CKKNRFGKPERPVKTVGVLGAGLMGAGIVQVSVDKGYQVVMKDATEAGLARGIGQVQKGL
ETAVKRKRISALERDQTLASLRPTLDYSDFKNADIIIEAVFEDIKVKHRVIKELEAVVPE
HCVIATNTSAIPITKIAAGSSRPEKVVGMHYFSPVDKMQLLEIITHPGTSKDTIAQAVAV
GLKQGKVVITVGDGPGFYTTRILSTMLSEAIRLLQEGVDPKDLDQYTKKFGFPVGAATLA
DEVGIDVGSHIAVDLAKAFGERFSGGNLEVMNDLVLAGFLGRKSGKGIFLYDGQKRGTRP
VNNDALEIVKQKYALVSKGANAPEDLTLRMVSRFINEAVLCLEEKILDSPLEGDVGAVFG
LGFPPFSGGPFRWVDQYGAGKLVSKMQSYAELYGAPFKPAQTLLDMAKDPSKKFYPKTGS
SKL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaacgaggtttttgagtgccgttggccaaatttcgcgacagcaattgctgcag
aataagtgcaccagagccctgcccatttcggcccagcttctccagaggcgccgcctaatg
tccacgaatcccgcaccggttgccaacaagcatctccacaccaaggtggtcaatggagtg
cttgtgatcaagatcgactcacccaatgccaaggtgaattccctgggctccgaagtgagc
gatgagttcgagcgagtgattaaggacctggagacgaatcctgccgtcaattccgccgtg
ctgatctcgggcaaaccgggctgctttgtggccggagccgacatcgggatgctggaagca
tgccagacggcggaggaggccacgctgatctcccacggcgcccaggtgatgttcgatcgc
atggagcgcagcaagaagcccattgtggccgccatcagcggagtctgtctgggtggtggt
ctggaactcgcccttgcctgccattaccgcattgccaccaaggacagcaagaccaaactg
ggtctgcccgaggtcatgctgggtctcctgcccggcggcggtggcaccgtccgcctgccc
aagcttacatccgtgcccacggctctggatatggagctgacaggcaaacaggtgcgcgcc
gatcgcgccaaacgactgggcatcgtggatctgttggtggatcccctaggtcctggactc
cagcctgctgagcaaaacactatcgagtacctggagaagaccgccgtgcaggtcgccaac
gatctggctagtggtaaacttcgcgtaaatcgcgagaaaagcggtctcgtcagcaagatc
cagtccttcgtcatggacaccgactttgtgaagaacaagattttcgacactgccaggaaa
caggtgctcaaggcctcgaacggtctctatcccgctcctctgaagattctcgatgtgatc
cgtgctggcgtggataagggaaccgatgccggttacgaggcggagcgcaagggcttcggc
gagctatcggccacgcccgagtcgaagggtttgattgccctgttccgtggacaaacggag
tgcaagaagaaccgatttggcaagccagagcgtccggttaagactgtgggtgtgctggga
gctggtctgatgggcgccggtattgtacaggtctccgtcgataagggatatcaggtggtg
atgaaggatgccaccgaagccggcctggctcgtggtattggacaagtgcagaagggtttg
gagacggctgtgaagcgcaagcgaatctctgcactggagcgcgatcagactcttgccagt
ctgcggcccactcttgattacagcgacttcaagaacgcagacatcatcatcgaagctgtt
ttcgaggacatcaaggttaagcatcgagtgatcaaggagctggaagcagtggttccagag
cactgcgtcattgccaccaacaccagcgccattcccatcaccaagattgctgctggaagc
tcgcgtcccgagaaggttgttggcatgcactacttctcgcccgtggacaagatgcagctg
ctggaaatcatcactcacccaggaacctccaaggacaccatcgcacaggccgtggccgtc
ggtctcaagcaaggcaaggtcgttatcactgttggtgacggacctggcttctataccacc
cgcatcctctccaccatgctgtcggaagccatcagactgctgcaggaaggcgtggacccc
aaggatctggaccaatacacgaagaagtttggcttccccgtgggtgctgcgacccttgcg
gatgaggttggcattgacgtgggttcccacattgccgtcgacttggcaaaggcattcggc
gaacgtttcagcggtggaaacttggaagtaatgaatgatctggtcctggctggtttcctc
ggacgcaagtccggcaagggtatcttcctgtacgatggccagaagaggggcactcgtcca
gtgaacaacgatgctctcgaaatcgtgaaacaaaagtacgctttagtctcaaagggagcc
aatgcccccgaggatctgacgctgcgtatggtatcccgcttcatcaacgaagccgtgctc
tgtctggaggagaagattctggacagtccgctggagggcgatgtcggagccgtgttcggc
ctgggcttcccgccattctccggtggtcccttccgctgggtcgatcagtatggagccggc
aaactggtcagcaagatgcaatcctatgctgagctgtacggagctcccttcaagcccgct
cagaccctgctcgacatggctaaggacccgtcgaagaagttctaccccaagactggctcc
tcgaagttgtag

DBGET integrated database retrieval system