KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4389Help
Entry
Dmel_CG4389       CDS       T00030                                 

Gene name
Mtpalpha
Definition
(RefSeq) mitochondrial trifunctional protein alpha subunit, isoform A
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00062  Fatty acid elongation
dme00071  Fatty acid degradation
dme00280  Valine, leucine and isoleucine degradation
dme00310  Lysine degradation
dme00380  Tryptophan metabolism
dme00410  beta-Alanine metabolism
dme00640  Propanoate metabolism
dme00650  Butanoate metabolism
dme01040  Biosynthesis of unsaturated fatty acids
dme01100  Metabolic pathways
dme01200  Carbon metabolism
dme01212  Fatty acid metabolism
Module
dme_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
dme_M00085  Fatty acid biosynthesis, elongation, mitochondria
dme_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dmel_CG4389 (Mtpalpha)
   00650 Butanoate metabolism
    Dmel_CG4389 (Mtpalpha)
  Lipid metabolism
   00062 Fatty acid elongation
    Dmel_CG4389 (Mtpalpha)
   00071 Fatty acid degradation
    Dmel_CG4389 (Mtpalpha)
   01040 Biosynthesis of unsaturated fatty acids
    Dmel_CG4389 (Mtpalpha)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dmel_CG4389 (Mtpalpha)
   00310 Lysine degradation
    Dmel_CG4389 (Mtpalpha)
   00380 Tryptophan metabolism
    Dmel_CG4389 (Mtpalpha)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dmel_CG4389 (Mtpalpha)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     Dmel_CG4389 (Mtpalpha)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dmel_CG4389 (Mtpalpha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 Ac81
Motif
Other DBs
NCBI-GeneID: 34276
NCBI-ProteinID: NP_609299
FlyBase: FBgn0028479
UniProt: Q9V397
Position
2L
AA seq 783 aa AA seqDB search
MSATRFLSAVGQISRQQLLQNKCTRALPISAQLLQRRRLMSTNPAPVANKHLHTKVVNGV
LVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADIGMLEA
CQTAEEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKL
GLPEVMLGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPGL
QPAEQNTIEYLEKTAVQVANDLASGKLRVNREKSGLVSKIQSFVMDTDFVKNKIFDTARK
QVLKASNGLYPAPLKILDVIRAGVDKGTDAGYEAERKGFGELSATPESKGLIALFRGQTE
CKKNRFGKPERPVKTVGVLGAGLMGAGIVQVSVDKGYQVVMKDATEAGLARGIGQVQKGL
ETAVKRKRISALERDQTLASLRPTLDYSDFKNADIIIEAVFEDIKVKHRVIKELEAVVPE
HCVIATNTSAIPITKIAAGSSRPEKVVGMHYFSPVDKMQLLEIITHPGTSKDTIAQAVAV
GLKQGKVVITVGDGPGFYTTRILSTMLSEAIRLLQEGVDPKDLDQYTKKFGFPVGAATLA
DEVGIDVGSHIAVDLAKAFGERFSGGNLEVMNDLVLAGFLGRKSGKGIFLYDGQKRGTRP
VNNDALEIVKQKYALVSKGANAPEDLTLRMVSRFINEAVLCLEEKILDSPLEGDVGAVFG
LGFPPFSGGPFRWVDQYGAGKLVSKMQSYAELYGAPFKPAQTLLDMAKDPSKKFYPKTGS
SKL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaacgaggtttttgagtgccgttggccaaatttcgcgacagcaattgctgcag
aataagtgcaccagagccctgcccatttcggcccagcttctccagaggcgccgcctaatg
tccacgaatcccgcaccggttgccaacaagcatctccacaccaaggtggtcaatggagtg
cttgtgatcaagatcgactcacccaatgccaaggtgaattccctgggctccgaagtgagc
gatgagttcgagcgagtgattaaggacctggagacgaatcctgccgtcaattccgccgtg
ctgatctcgggcaaaccgggctgctttgtggccggagccgacatcgggatgctggaagca
tgccagacggcggaggaggccacgctgatctcccacggcgcccaggtgatgttcgatcgc
atggagcgcagcaagaagcccattgtggccgccatcagcggagtctgtctgggtggtggt
ctggaactcgcccttgcctgccattaccgcattgccaccaaggacagcaagaccaaactg
ggtctgcccgaggtcatgctgggtctcctgcccggcggcggtggcaccgtccgcctgccc
aagcttacatccgtgcccacggctctggatatggagctgacaggcaaacaggtgcgcgcc
gatcgcgccaaacgactgggcatcgtggatctgttggtggatcccctaggtcctggactc
cagcctgctgagcaaaacactatcgagtacctggagaagaccgccgtgcaggtcgccaac
gatctggctagtggtaaacttcgcgtaaatcgcgagaaaagcggtctcgtcagcaagatc
cagtccttcgtcatggacaccgactttgtgaagaacaagattttcgacactgccaggaaa
caggtgctcaaggcctcgaacggtctctatcccgctcctctgaagattctcgatgtgatc
cgtgctggcgtggataagggaaccgatgccggttacgaggcggagcgcaagggcttcggc
gagctatcggccacgcccgagtcgaagggtttgattgccctgttccgtggacaaacggag
tgcaagaagaaccgatttggcaagccagagcgtccggttaagactgtgggtgtgctggga
gctggtctgatgggcgccggtattgtacaggtctccgtcgataagggatatcaggtggtg
atgaaggatgccaccgaagccggcctggctcgtggtattggacaagtgcagaagggtttg
gagacggctgtgaagcgcaagcgaatctctgcactggagcgcgatcagactcttgccagt
ctgcggcccactcttgattacagcgacttcaagaacgcagacatcatcatcgaagctgtt
ttcgaggacatcaaggttaagcatcgagtgatcaaggagctggaagcagtggttccagag
cactgcgtcattgccaccaacaccagcgccattcccatcaccaagattgctgctggaagc
tcgcgtcccgagaaggttgttggcatgcactacttctcgcccgtggacaagatgcagctg
ctggaaatcatcactcacccaggaacctccaaggacaccatcgcacaggccgtggccgtc
ggtctcaagcaaggcaaggtcgttatcactgttggtgacggacctggcttctataccacc
cgcatcctctccaccatgctgtcggaagccatcagactgctgcaggaaggcgtggacccc
aaggatctggaccaatacacgaagaagtttggcttccccgtgggtgctgcgacccttgcg
gatgaggttggcattgacgtgggttcccacattgccgtcgacttggcaaaggcattcggc
gaacgtttcagcggtggaaacttggaagtaatgaatgatctggtcctggctggtttcctc
ggacgcaagtccggcaagggtatcttcctgtacgatggccagaagaggggcactcgtcca
gtgaacaacgatgctctcgaaatcgtgaaacaaaagtacgctttagtctcaaagggagcc
aatgcccccgaggatctgacgctgcgtatggtatcccgcttcatcaacgaagccgtgctc
tgtctggaggagaagattctggacagtccgctggagggcgatgtcggagccgtgttcggc
ctgggcttcccgccattctccggtggtcccttccgctgggtcgatcagtatggagccggc
aaactggtcagcaagatgcaatcctatgctgagctgtacggagctcccttcaagcccgct
cagaccctgctcgacatggctaaggacccgtcgaagaagttctaccccaagactggctcc
tcgaagttgtag

DBGET integrated database retrieval system