KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4574Help
Entry
Dmel_CG4574       CDS       T00030                                 

Gene name
Plc21C
Definition
Phospholipase C at 21C (EC:3.1.4.11)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dme00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dme04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dme04070]
Organismal Systems; Sensory system; Phototransduction - fly [PATH:dme04745]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:21B8-21C1
AA seq 1250 aa AA seqDB search
MMSAGGTYISTASVEVPQALQDGEKFIRWDDDSGTGTPVTMRVDAKGFFLYWVDQNNELD
ILDIATIRDVRTGQYAKRPKDNKLRQIVTLGPQDTLEEKTVTVCHGSDFVNMTFVNFCCT
RRDIAQLWTDGLIKLAYSLAQLNGSAIMFLQKAHTKLCLQVDKSGRIPVKNIIKLFAQNK
EDRKRVEKALDVTGLPSGKVDSISVSKFQFEDFYNLYKYLTQRSEVERLFDSIVGNSKRK
CMSIAQLVEFLNKTQRDPRLNEILYPYANPARAKELIQQYEPNKFNAQKGQLSLDGFLRC
VELDFWNGRTEEPVIVHGYTFVPEIFAKDVLEAIAESAFKTSEYPVILSFENHCNPRQQA
KIANYCREIFGDMLLDKPLDSHPLEPNMDLPPPAMLRRKIIIKNKKKHHHHHHHHHHKKP
AQVGTPAANNKLTTANSVDAKAAQQVGLSASHEDGGVTRSTANGDVATGTGTGSAAGTAG
HAPPLQQIRQSSKDSTGSSDSDSSSEDESLPNTTPNLPSGNEPPPEKAQKETEAGAEISA
LVNYVQPIHFSSFENAEKKNRCYEMSSFDEKQATTLLKERPIEFVNYNKHQLSRVYPAGT
RFDSSNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNARSGYLLKPEFMRRSDRRL
DPFAESTVDGIIAGTVSITVLSGQFLTDKRANTFVEVDMYGLPADTVRKKFRTKTVRDNG
MNPLYDEEPFVFKKVVLPELASIRIAAYEEGGKLIGHRVLPVIGLCPGYRHVNLRSEVGQ
PIALASLFLCVVVKDYVPDDLSNFAEALANPIKYQSELEKRDIQLSVLTDEAEALGSADE
DLSKSFVFVQVGGQKKELRPVESLATSPKHRPSISAAAAMSVDVTVDRTDGGRGEDSISI
VAPSIQHQHSLDQSVSTSIRQVESSQFDVDLVLAEPLEKILDHKSVKEKRLEMEKKLESL
RKKHDKEKIKIAGQKSSPLEGKKPKFAITNKLVKRLSNKSLEPGVEIPACPLDLGDSSEE
SAAADAGEDLAGGSSSLDGRTQESRLRSACREYTSQYRELQEKYHEAIYSAAEKVLKTSQ
TGQTKQLKASLDKVTGEVMHQLQEARRNEVKNLATVHRDRDELIRMKREVASSVVERGVA
ERVRLKQTFDRRTDELQKQHDSVRNALAEHRSKARQILDKEAESRSCVSSNGFLVLFHGP
HHHGCTGSGSSALSGNNLTLNLDAGAAGSHSAISPAKSHNSIAAAAEMKT
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgccggaggaacctacatctccaccgccagcgtggaggtgccacaagctctg
caagatggcgagaagttcattcgatgggatgatgactcgggcactggaacaccggttaca
atgcgcgtcgatgccaagggcttcttcctctactgggtcgaccagaacaacgagctggat
atccttgatatagccaccatacgcgacgttcgcacaggacagtacgctaagcgaccaaag
gacaacaagctgcgccagattgtgacgctgggcccccaggacacgctcgaggagaagaca
gtgacggtatgccacggctcggacttcgtcaacatgacgttcgtcaacttctgctgcacc
cggcgggacatagcccagctctggaccgacggactcatcaagttggcctacagcttggcc
cagctcaatggctcggcgattatgttcctgcagaaggcccataccaaactgtgtctccag
gtggacaaaagcggccgcataccagtgaaaaacatcataaaactttttgcccaaaacaag
gaggatcgcaaacgtgtcgagaaggcgctggacgtgaccggtttgccgtcgggaaaggtc
gatagcatatcggtgtccaaatttcaattcgaggacttttacaatttgtacaaatatctc
acgcagcgttcggaggtggaacgcctctttgacagcatcgttggcaactcgaagcgcaag
tgcatgtccatcgctcaactggtggagttcctgaacaagacacagcgtgatccccgcctg
aacgagatcctctacccttatgcgaatcccgcccgcgccaaggagctcatccagcaatat
gagcccaacaagttcaatgcgcaaaagggccaactcagcctggatggctttttgagatgc
gttgagctcgacttctggaacggacgcaccgaggagccagtcattgtccacggctatacg
ttcgtgcccgagatatttgccaaggacgtgctggaggccatcgcagagagtgcatttaaa
acatccgaataccctgtgatattgagctttgagaatcactgcaaccctaggcaacaggcg
aaaattgccaactattgtcgcgaaatatttggcgatatgctgctcgataagcctctggac
tctcatccgctggagccgaacatggacttgccaccgccggcgatgctgcgccgcaagatt
ataatcaagaacaagaagaagcatcaccaccaccatcaccatcatcaccacaaaaagcca
gcgcaggtgggcacgccggcagccaacaacaaactgactacagcgaattcagtggatgcc
aaggcggcgcaacaagtcggtttgtcggcctcgcatgaggatgggggcgtgaccaggagc
accgccaacggtgacgttgccactggaacaggaaccggaagtgctgctgggacagcagga
cacgcgccgccgttgcaacaaatccgccaaagctccaaagacagcactggatcctccgat
tcggacagctcttcggaggatgaatccctgcctaacaccacgcccaatttgcccagcggc
aacgaacctccgccagaaaaggctcaaaaggaaacggaggcgggagcagagatttcagct
ttggtcaactatgttcagcccatccattttagctcttttgagaatgcggaaaaaaagaat
cgatgctacgaaatgtcttcgtttgatgaaaaacaggcgacaacattattgaaggagcga
ccgattgaatttgtgaactacaacaaacaccaattatctcgtgtctatccggcgggcact
cgctttgatagctccaactttatgccgcagttgttctggaatgccggatgtcagctcgtg
gcacttaacttccaaaccctcgatctggccatgcaactcaacttggggatctttgagtat
aacgctcggtccggttatctacttaagccggagtttatgcgccgatcagatcgcagattg
gatcccttcgcggaaagcactgtggatggcatcatagcaggcacagtatcaatcacggtt
ctatctggtcagtttctcacggataagagggcgaacacttttgtggaagttgatatgtac
ggtttgccagcggacacggtgagaaagaagtttcgcaccaagacagtgcgggataatgga
atgaatcccctttatgacgaggagccgttcgtgtttaagaaggtggttctccccgagttg
gcgagcattcgaattgcagcatatgaagagggtggcaaactcattggtcaccgcgttttg
cccgtaatcggtctttgccctggttaccgacatgtgaatctccgatctgaagtgggtcaa
ccaatagcccttgcctctcttttcctgtgcgtggtggtcaaggattatgtacccgatgat
ctttccaatttcgcagaggcgctagctaaccctattaaataccaaagtgagctagagaag
cgcgatattcaactatctgttttgaccgacgaagccgaagcgctgggcagtgcggacgag
gatctctccaagtcgttcgttttcgtccaagtaggtggccaaaaaaaggagctgcgtccg
gttgaatcgcttgcgacttcgccgaagcataggccgagcatctcggccgccgcagcaatg
agtgttgacgttaccgtggatcggaccgatggcggaaggggagaagatagcatctctatt
gtagcaccctcaatacagcatcagcactctctagaccagtccgtaagcacctccatccga
caggtggagtcctcgcagtttgatgtcgatcttgtgttggcggagccgctggaaaagata
ttggatcacaagtccgtcaaggaaaagcgtctcgagatggaaaagaagctggagtcactg
cgaaagaagcatgacaaggaaaagattaagatcgccggccagaaatccagtccgctagag
ggcaagaagccgaagtttgccatcacgaataagctggtgaagcggctaagcaacaagagt
ctcgagcctggtgtagagatccccgcctgccctctggatctgggcgatagcagcgaggag
agtgcagccgcggatgccggtgaggacttagccggtgggagcagcagtctggatggcaga
actcaagagtcgcgattacgcagtgcctgccgggagtacacttcccagtaccgtgagctg
caggagaagtaccatgaggcaatttacagtgcagccgagaaggtgctgaagacatcgcaa
actgggcaaacaaagcagttaaaagcatctctggacaaggtcactggagaggttatgcac
cagctgcaggaggcccgccgcaacgaggttaagaatctggccaccgtgcaccgggatcgt
gatgagctgatcagaatgaaacgcgaggtggcaagctccgttgtggaacgtggcgtagct
gaacgtgtgcggctgaagcagacctttgaccggagaacggatgaacttcagaagcagcac
gactcagtgcgcaatgccctggcagagcaccgctccaaggctcgtcaaattctcgacaag
gaggcagaatcgcgaagctgtgtatccagcaatggcttcttggtcctcttccatggacct
catcaccatggctgtacgggctccggctcgtcagccctttcaggcaataatctcactcta
aatctggacgcgggggctgccggtagtcattcagccatttcgccggcaaagtcgcacaac
agcatcgcagcagcggccgagatgaagacgtaa

DBGET integrated database retrieval system