KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4574Help
Entry
Dmel_CG4574       CDS       T00030                                 

Gene name
Plc21C
Definition
(RefSeq) Phospholipase C at 21C (EC:3.1.4.11)
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dmel_CG4574 (Plc21C)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG4574 (Plc21C)
   04070 Phosphatidylinositol signaling system
    Dmel_CG4574 (Plc21C)
 Organismal Systems
  Sensory system
   04745 Phototransduction - fly
    Dmel_CG4574 (Plc21C)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dmel_CG4574 (Plc21C)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Dmel_CG4574 (Plc21C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:21B8-21C1
AA seq 1318 aa AA seqDB search
MMSAGGTYISTASVEVPQALQDGEKFIRWDDDSGTGTPVTMRVDAKGFFLYWVDQNNELD
ILDIATIRDVRTGQYAKRPKDNKLRQIVTLGPQDTLEEKTVTVCHGSDFVNMTFVNFCCT
RRDIAQLWTDGLIKLAYSLAQLNGSAIMFLQKAHTKLCLQVDKSGRIPVKNIIKLFAQNK
EDRKRVEKALDVTGLPSGKVDSISVSKFQFEDFYNLYKYLTQRSEVERLFDSIVGNSKRK
CMSIAQLVEFLNKTQRDPRLNEILYPYANPARAKELIQQYEPNKFNAQKGQLSLDGFLRY
LMGDDNPIMAPSKLDLCDDMDQPMSHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLAGCR
CVELDFWNGRTEEPVIVHGYTFVPEIFAKDVLEAIAESAFKTSEYPVILSFENHCNPRQQ
AKIANYCREIFGDMLLDKPLDSHPLEPNMDLPPPAMLRRKIIIKNKKKHHHHHHHHHHKK
PAQVGTPAANNKLTTANSVDAKAAQQVGLSASHEDGGVTRSTANGDVATGTGTGSAAGTA
GHAPPLQQIRQSSKDSTGSSDSDSSSEDESLPNTTPNLPSGNEPPPEKAQKETEAGAEIS
ALVNYVQPIHFSSFENAEKKNRCYEMSSFDEKQATTLLKERPIEFVNYNKHQLSRVYPAG
TRFDSSNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNARSGYLLKPEFMRRSDRR
LDPFAESTVDGIIAGTVSITVLSGQFLTDKRANTFVEVDMYGLPADTVRKKFRTKTVRDN
GMNPLYDEEPFVFKKVVLPELASIRIAAYEEGGKLIGHRVLPVIGLCPGYRHVNLRSEVG
QPIALASLFLCVVVKDYVPDDLSNFAEALANPIKYQSELEKRDIQLSVLTDEAEALGSAD
EDLSKSFVFVQVGGQKKELRPVESLATSPKHRPSISAAAAMSVDVTVDRTDGGRGEDSIS
IVAPSIQHQHSLDQSVSTSIRQVESSQFDVDLVLAEPLEKILDHKSVKEKRLEMEKKLES
LRKKHDKEKIKIAGQKSSPLEGKKPKFAITNKLVKRLSNKSLNCLSPHSEPGVEIPACPL
DLGDSSEESAAADAGEDLAGGSSSLDGRTQESRLRSACREYTSQYRELQEKYHEAIYSAA
EKVLKTSQTGQTKQLKASLDKVTGEVMHQLQEARRNEVKNLATVHRDRDELIRMKREVAS
SVVERGVAERVRLKQTFDRRTDELQKQHDSVRNALAEHRSKARQILDKEAESRSCVSSNG
FLVLFHGPHHHGCTGSGSSALSGNNLTLNLDAGAAGSHSAISPAKSHNSIAAAAEMKT
NT seq 3957 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgccggaggaacctacatctccaccgccagcgtggaggtgccacaagctctg
caagatggcgagaagttcattcgatgggatgatgactcgggcactggaacaccggttaca
atgcgcgtcgatgccaagggcttcttcctctactgggtcgaccagaacaacgagctggat
atccttgatatagccaccatacgcgacgttcgcacaggacagtacgctaagcgaccaaag
gacaacaagctgcgccagattgtgacgctgggcccccaggacacgctcgaggagaagaca
gtgacggtatgccacggctcggacttcgtcaacatgacgttcgtcaacttctgctgcacc
cggcgggacatagcccagctctggaccgacggactcatcaagttggcctacagcttggcc
cagctcaatggctcggcgattatgttcctgcagaaggcccataccaaactgtgtctccag
gtggacaaaagcggccgcataccagtgaaaaacatcataaaactttttgcccaaaacaag
gaggatcgcaaacgtgtcgagaaggcgctggacgtgaccggtttgccgtcgggaaaggtc
gatagcatatcggtgtccaaatttcaattcgaggacttttacaatttgtacaaatatctc
acgcagcgttcggaggtggaacgcctctttgacagcatcgttggcaactcgaagcgcaag
tgcatgtccatcgctcaactggtggagttcctgaacaagacacagcgtgatccccgcctg
aacgagatcctctacccttatgcgaatcccgcccgcgccaaggagctcatccagcaatat
gagcccaacaagttcaatgcgcaaaagggccaactcagcctggatggctttttgaggtac
ttaatgggcgacgacaatcccatcatggcgcccagcaagctcgatctctgcgatgacatg
gaccagccgatgtcgcactacttcatcaactcctcgcataacacctacttgacgggacac
cagctgaccggcaagtcgtccgtcgagatttacaggcagtgtctcctggcgggatgcaga
tgcgttgagctcgacttctggaacggacgcaccgaggagccagtcattgtccacggctat
acgttcgtgcccgagatatttgccaaggacgtgctggaggccatcgcagagagtgcattt
aaaacatccgaataccctgtgatattgagctttgagaatcactgcaaccctaggcaacag
gcgaaaattgccaactattgtcgcgaaatatttggcgatatgctgctcgataagcctctg
gactctcatccgctggagccgaacatggacttgccaccgccggcgatgctgcgccgcaag
attataatcaagaacaagaagaagcatcaccaccaccatcaccatcatcaccacaaaaag
ccagcgcaggtgggcacgccggcagccaacaacaaactgactacagcgaattcagtggat
gccaaggcggcgcaacaagtcggtttgtcggcctcgcatgaggatgggggcgtgaccagg
agcaccgccaacggtgacgttgccactggaacaggaaccggaagtgctgctgggacagca
ggacacgcgccgccgttgcaacaaatccgccaaagctccaaagacagcactggatcctcc
gattcggacagctcttcggaggatgaatccctgcctaacaccacgcccaatttgcccagc
ggcaacgaacctccgccagaaaaggctcaaaaggaaacggaggcgggagcagagatttca
gctttggtcaactatgttcagcccatccattttagctcttttgagaatgcggaaaaaaag
aatcgatgctacgaaatgtcttcgtttgatgaaaaacaggcgacaacattattgaaggag
cgaccgattgaatttgtgaactacaacaaacaccaattatctcgtgtctatccggcgggc
actcgctttgatagctccaactttatgccgcagttgttctggaatgccggatgtcagctc
gtggcacttaacttccaaaccctcgatctggccatgcaactcaacttggggatctttgag
tataacgctcggtccggttatctacttaagccggagtttatgcgccgatcagatcgcaga
ttggatcccttcgcggaaagcactgtggatggcatcatagcaggcacagtatcaatcacg
gttctatctggtcagtttctcacggataagagggcgaacacttttgtggaagttgatatg
tacggtttgccagcggacacggtgagaaagaagtttcgcaccaagacagtgcgggataat
ggaatgaatcccctttatgacgaggagccgttcgtgtttaagaaggtggttctccccgag
ttggcgagcattcgaattgcagcatatgaagagggtggcaaactcattggtcaccgcgtt
ttgcccgtaatcggtctttgccctggttaccgacatgtgaatctccgatctgaagtgggt
caaccaatagcccttgcctctcttttcctgtgcgtggtggtcaaggattatgtacccgat
gatctttccaatttcgcagaggcgctagctaaccctattaaataccaaagtgagctagag
aagcgcgatattcaactatctgttttgaccgacgaagccgaagcgctgggcagtgcggac
gaggatctctccaagtcgttcgttttcgtccaagtaggtggccaaaaaaaggagctgcgt
ccggttgaatcgcttgcgacttcgccgaagcataggccgagcatctcggccgccgcagca
atgagtgttgacgttaccgtggatcggaccgatggcggaaggggagaagatagcatctct
attgtagcaccctcaatacagcatcagcactctctagaccagtccgtaagcacctccatc
cgacaggtggagtcctcgcagtttgatgtcgatcttgtgttggcggagccgctggaaaag
atattggatcacaagtccgtcaaggaaaagcgtctcgagatggaaaagaagctggagtca
ctgcgaaagaagcatgacaaggaaaagattaagatcgccggccagaaatccagtccgcta
gagggcaagaagccgaagtttgccatcacgaataagctggtgaagcggctaagcaacaag
agtcttaattgtctttctccgcacagcgagcctggtgtagagatccccgcctgccctctg
gatctgggcgatagcagcgaggagagtgcagccgcggatgccggtgaggacttagccggt
gggagcagcagtctggatggcagaactcaagagtcgcgattacgcagtgcctgccgggag
tacacttcccagtaccgtgagctgcaggagaagtaccatgaggcaatttacagtgcagcc
gagaaggtgctgaagacatcgcaaactgggcaaacaaagcagttaaaagcatctctggac
aaggtcactggagaggttatgcaccagctgcaggaggcccgccgcaacgaggttaagaat
ctggccaccgtgcaccgggatcgtgatgagctgatcagaatgaaacgcgaggtggcaagc
tccgttgtggaacgtggcgtagctgaacgtgtgcggctgaagcagacctttgaccggaga
acggatgaacttcagaagcagcacgactcagtgcgcaatgccctggcagagcaccgctcc
aaggctcgtcaaattctcgacaaggaggcagaatcgcgaagctgtgtatccagcaatggc
ttcttggtcctcttccatggacctcatcaccatggctgtacgggctccggctcgtcagcc
ctttcaggcaataatctcactctaaatctggacgcgggggctgccggtagtcattcagcc
atttcgccggcaaagtcgcacaacagcatcgcagcagcggccgagatgaagacgtaa

DBGET integrated database retrieval system