KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5044Help
Entry
Dmel_CG5044       CDS       T00030                                 

Definition
(RefSeq) CG5044, isoform A
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00280  Valine, leucine and isoleucine degradation
dme00410  beta-Alanine metabolism
dme00640  Propanoate metabolism
dme01100  Metabolic pathways
dme01200  Carbon metabolism
Module
dme_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dmel_CG5044
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dmel_CG5044
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dmel_CG5044
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     Dmel_CG5044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 CHIPS TBPIP
Motif
Other DBs
NCBI-GeneID: 41869
NCBI-ProteinID: NP_650453
FlyBase: FBgn0038326
UniProt: Q960K8
Position
3R
AA seq 385 aa AA seqDB search
MGPIQRLVYTFGHRTCSQLPMIGGATISQTKPTTMALSVRQSSSSVLATESSNKGMIILN
RPKALNAINLEMVRKIYKHLKKCEKSKSLVIIKGTGDKAFCAGGDVRALVEAGPTDESKS
FFREEYSTNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFP
DVGGSYFLPRLQGKLGLYLGLTGYRLRGADVYYSGIATHYCESSKIPDLETALLNCPDAD
DVPELLQKYHSPPEKPFSLQPVLEQINKNFSADSVEGILENLQNDGSEWAKKTLETLSKM
SPTSMKVTFRQLELGSQLSLAQCLIMEYRLAVRHLERSDFKEGVRALLIDKDQKPQWQPT
KLADVTEEHVQWFFRKLPDTEELKL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgggcccaattcaaaggttggtgtacacatttggtcatcgcacctgtagccaattgccg
atgatcggcggagcaacgatatcccaaacaaaaccaacaacaatggctctctccgttcgc
caatcctcctcctccgtgctggccacggagtcctctaacaagggaatgattattctgaac
cggcccaaggcgcttaacgccatcaacttggagatggtacgcaagatctacaagcacctg
aagaagtgcgagaagtccaagtcgctggtgatcatcaagggcacaggtgacaaggccttc
tgcgccggtggagatgtgcgcgctctggtcgaggctggccctacggatgagtcgaagagc
ttcttccgggaggagtacagcacgaatgccctgatcggaaactataagattccctacatc
gccatcattgacggtattaccatgggcggtggcgtgggtctgagtgtgcatggcaagtac
cgggtggccagcgatcggacactgttcgccatgcccgagacggcgattggcctcttcccg
gatgtgggtggatcatacttcctgcctcgactgcagggaaagctgggcctctatctgggt
ctcacaggatatcgactgcgcggagccgatgtctattactcaggcattgctacgcactac
tgcgagagcagcaagatccctgatctggagacggctctccttaactgcccggatgcggat
gatgtgcctgagctgctgcagaagtaccattccccgccagaaaagcccttctcgctgcag
cctgtcctggagcagatcaacaagaacttttcagcggactcggtggaggggattctagag
aatctgcagaacgatggcagtgaatgggccaagaagacgcttgagacgctctcgaagatg
tctcccacctcgatgaaggttacgttccgtcagttggagctcggatcacagctgtcgctg
gctcagtgtcttattatggaatatcgtctggccgtgcgtcatctggagcgaagtgatttc
aaggagggagtgcgcgccctactcatcgacaaggatcagaagccccagtggcagccaacc
aagctggccgatgtcactgaggaacatgtgcagtggtttttccgcaagctaccggacacc
gaggaactcaagctgtaa

DBGET integrated database retrieval system