KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5285Help
Entry
Dmel_CG5285       CDS       T00030                                 

Definition
CG5285 gene product from transcript CG5285-RA (EC:3.2.2.-)
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:dme03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:89F1-89F1
AA seq 280 aa AA seqDB search
MLKRKLNQQKCNLEIGEPTKTSARQGSTSEFFDKPLWLKFYETEVKLNEALEKLNPPEST
PFIYNPIVYASQLHCDYLRRYMDGPKKLVFVGMNPGPNGMAQTGIPFGNVRTVKLLMQLA
GSVDQPPVVHPKRPVAGLDCRIEEPSGVRLWELFLRLAGSMQTFSQQCFVHNFCPLAFFG
ADGRNITPSEIRGAYKNQLGDLCLHTLEEQLKLLQPDVIVAVGEYVHSALKRSGYAKSNC
VSVLRLPHPSPRSTNNTNWPEKAQAFLEEHNLIRFMRNEA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgcaaactgaaccagcaaaaatgcaatctggagattggggagcccactaag
acatccgcaaggcagggcagtacatcggaattctttgataagccgctgtggcttaaattc
tacgaaaccgaagtcaagttaaatgaggcgctggaaaaactgaatcctcctgagagcaca
ccgttcatctacaacccgatagtatatgcatcccagctgcactgcgactatttacgtcgc
tatatggacggtcccaagaagctggtatttgttggcatgaatccagggcccaatggaatg
gcccaaaccggaattccctttggcaatgtgcgcacagtaaagttgttaatgcagctggct
ggttcggtggaccaacctccagtcgtgcatcccaaacgtccagtcgctggcttggattgt
cggattgaggagcccagtggtgtgcgtttgtgggagctgttcctccgactggctggcagc
atgcagaccttctcccagcagtgtttcgtccacaatttctgtccgctagctttctttggc
gcagatggcaggaacataacgcccagtgaaatcagaggagcttacaaaaatcagctagga
gacctgtgcctgcacaccctggaggaacaactgaagctcctccaacccgacgtgattgtg
gccgttggggagtatgttcacagcgcactgaagcgttcaggatatgccaaatccaattgc
gtttcggtgctccgactgccgcatcctagtccgcgttctactaataataccaattggccc
gagaaggctcaagcatttttggaggagcacaacctaatccgattcatgcggaatgaggct
tga

DBGET integrated database retrieval system