KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5285Help
Entry
Dmel_CG5285       CDS       T00030                                 

Definition
CG5285 gene product from transcript CG5285-RA (EC:3.2.2.-)
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dmel_CG5285
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dmel_CG5285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:89F1-89F1
AA seq 280 aa AA seqDB search
MLKRKLNQQKCNLEIGEPTKTSARQGSTSEFFDKPLWLKFYETEVKLNEALEKLNPPEST
PFIYNPIVYASQLHCDYLRRYMDGPKKLVFVGMNPGPNGMAQTGIPFGNVRTVKLLMQLA
GSVDQPPVVHPKRPVAGLDCRIEEPSGVRLWELFLRLAGSMQTFSQQCFVHNFCPLAFFG
ADGRNITPSEIRGAYKNQLGDLCLHTLEEQLKLLQPDVIVAVGEYVHSALKRSGYAKSNC
VSVLRLPHPSPRSTNNTNWPEKAQAFLEEHNLIRFMRNEA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgcaaactgaaccagcaaaaatgcaatctggagattggggagcccactaag
acatccgcaaggcagggcagtacatcggaattctttgataagccgctgtggcttaaattc
tacgaaaccgaagtcaagttaaatgaggcgctggaaaaactgaatcctcctgagagcaca
ccgttcatctacaacccgatagtatatgcatcccagctgcactgcgactatttacgtcgc
tatatggacggtcccaagaagctggtatttgttggcatgaatccagggcccaatggaatg
gcccaaaccggaattccctttggcaatgtgcgcacagtaaagttgttaatgcagctggct
ggttcggtggaccaacctccagtcgtgcatcccaaacgtccagtcgctggcttggattgt
cggattgaggagcccagtggtgtgcgtttgtgggagctgttcctccgactggctggcagc
atgcagaccttctcccagcagtgtttcgtccacaatttctgtccgctagctttctttggc
gcagatggcaggaacataacgcccagtgaaatcagaggagcttacaaaaatcagctagga
gacctgtgcctgcacaccctggaggaacaactgaagctcctccaacccgacgtgattgtg
gccgttggggagtatgttcacagcgcactgaagcgttcaggatatgccaaatccaattgc
gtttcggtgctccgactgccgcatcctagtccgcgttctactaataataccaattggccc
gagaaggctcaagcatttttggaggagcacaacctaatccgattcatgcggaatgaggct
tga

DBGET integrated database retrieval system