KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5499Help
Entry
Dmel_CG5499       CDS       T00030                                 

Gene name
His2Av
Definition
Histone H2A variant
Orthology
K11251  
histone H2A
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:97D3-97D3
AA seq 141 aa AA seqDB search
MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKEETVQDPQRKGNVILSQAY
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggctggcggtaaagcaggcaaggattcgggcaaggccaaggcgaaggcggtatcgcgt
tccgcgcgcgcgggtcttcagttccccgtgggtcgcatccatcgtcatctcaagagccgc
actacgtcacatggacgcgtcggagccactgcagccgtgtactccgctgccatattggaa
tacctgaccgccgaggtcctggagttggcaggcaacgcatcgaaggacttgaaagtgaaa
cgtatcactcctcgccacttacagctcgccattcgcggagacgaggagctggacagcctg
atcaaggcaaccatcgctggtggcggtgtcattccgcacatacacaagtcgctgatcggc
aaaaaggaggaaacggtgcaggatccgcagcggaagggcaacgtcattctgtcgcaggcc
tactaa

DBGET integrated database retrieval system