KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7470Help
Entry
Dmel_CG7470       CDS       T00030                                 

Definition
CG7470 gene product from transcript CG7470-RB (EC:1.2.1.41 2.7.2.11)
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dmel_CG7470
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dmel_CG7470
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     Dmel_CG7470
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dmel_CG7470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:79A5-79A6
AA seq 776 aa AA seqDB search
MLQNSFKLAQSLRNGFYRNAWRAFSSHGPRQPLVSPERRLEKAHPTFTERSQLKYARRLV
VKLGSAVITREDNHGLALGRLASIVEQVAECHLEGREVMMVTSGAVAFGKQKLAQELLMS
LSMRETLNPKDSKEFDGATLEPRAAAAVGQSGLMSLYDAMFAQYGVKIAQVLVTKPDFYN
EETRNNLFCTLSELISLNIVPIINTNDAVSPPMFIRDDEPAGGARRGIPIKDNDSLSAML
AAEVQADLLILMSDVDGIYNKPPWEDGAKLMHTYTSDDSNSIEFGKKSKVGTGGMDSKVK
AATWALDRGVSVVICNGMQEKAIKTIIGGRKVGTFFTEATESANAVPVEVMAENARTGSR
QMQALTPAQRASAVNTLADLLVSREKFILDANAKDLAEAQKSGLAKPLLSRLSLNPAKLK
NLSVGLKQIAEDSHKNVGRVLRRTRLADQLELKQVTVPIGVLLVIFESRPDSLPQVAALA
MASANGLLLKGGKEAAHSNKALMELVKEALATVGAEHAVSLVSTREEISDLLSMENHIDL
IIPRGSSDLVRSIQQQSLHIPVLGHAEGVCHVYIDRDADLEKALRIARDAKCDYPAACNA
METLLIHEDLMSGAIFGDVCNMLKREGVKIYAGPRLNQQLTFGPPAAKSLKHEYGALECC
IEVVPSLDEAINHIHTYGSSHTDVIVTENDAAARQFLGSVDSACVFHNASSRFADGFRFG
LGAEVGISTARIHARGPVGVEGLLTTKWILEGQDHAAADFAEGGGRTWLHETLPLD
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaaacagtttcaaactggcccagagccttcgaaacggcttctacagaaacgcc
tggcgagcgttcagctcccacggaccccggcagccactggtttcgccggagcggcgcttg
gaaaaggcgcatccaaccttcacggaaaggagtcagttgaagtacgcccggaggctggtg
gtcaagttgggcagtgcagtcattactcgagaggacaaccatggactagccctcggccgt
ctggcctctattgtggagcaggttgccgagtgccatttggaaggacgtgaagtgatgatg
gtcaccagcggagcggtggcctttggaaagcagaagctcgcccaggagctgctcatgtcg
ctgtccatgcgcgagacactaaacccaaaagatagcaaagagtttgacggcgctacgctg
gaaccgcgagcagcggctgcggtgggtcagtcgggtctgatgtccctctacgacgcgatg
tttgcccagtacggcgtcaagatagcccaggtgctcgtgaccaagccggacttttacaac
gaggaaacacgcaacaatctcttctgcacgctctccgaattaattagcctgaatattgtg
ccaatcataaatactaacgacgccgtctccccgccaatgttcatacgtgacgacgagcca
gccggcggagcccggaggggtattcccattaaggacaacgacagcttgtctgccatgctg
gccgccgaggtgcaggcggatctgctaatcctcatgtcggacgtcgatggcatctacaat
aagccgccgtgggaggacggggccaagctgatgcacacatacaccagcgacgacagcaac
agcatcgagtttggcaaaaagtcaaaggtgggtactggcggcatggactccaaggtgaag
gcagccacctgggccctggaccggggcgtcagcgtggtcatctgcaacggaatgcaggag
aaggccatcaaaaccataattggcggccggaaggtgggcaccttcttcacggaggccacc
gagagcgccaatgcagtgccagtcgaggtgatggccgagaacgcgcgaaccgggagtcgc
cagatgcaggccctcacgcccgctcagagggccagtgctgtcaacaccctggccgatctg
ttggtgagccgcgagaagtttatcctggacgccaatgccaaggacctggccgaggcgcag
aagagcggactggccaagccgttgctgtcgcggctctcgctcaacccggccaagctaaag
aacctctccgttggcctgaagcaaatcgccgaggacagtcacaagaatgttggtcgtgtc
ctgagacgcacccgccttgcggatcagctggagctcaagcaggtcactgtgcccataggc
gtcctactggtcatcttcgaatcccgcccagactcgctgcctcaagtggccgccttggca
atggcctcggccaacggactgctcctcaaggggggcaaggaggcggcacacagcaacaag
gcccttatggagctggtcaaggaggcgctggccaccgtgggagcggagcacgccgtgtca
ctggtttccacgcgcgaggagatcagcgatctgctgtccatggagaaccacatcgacctg
atcattccgcgcggctcctccgacctggtgcgcagcatccagcagcagtcgctgcacatc
cccgtgctgggccacgccgaaggcgtctgccacgtctatatcgacagggatgcggatctg
gagaaggccctgcgcattgcacgcgacgccaagtgcgattatccggctgcttgcaacgcc
atggagaccctgctgatccacgaggacctgatgagtggcgcaatcttcggcgatgtctgc
aacatgctgaaacgtgagggcgtcaaaatctatgccggaccccggctgaaccagcagctg
acatttggcccgccggcggccaagagcctgaagcacgagtacggcgccctcgagtgctgc
atcgaggttgtgcccagcctggacgaggccattaatcacatccatacgtacggcagcagc
cacacggatgtcattgttacggaaaatgatgcggcggccaggcagttcctgggcagcgtg
gacagcgcctgtgtgttccacaacgccagctcccggtttgcggacggtttccggtttggc
cttggtgccgaggtgggcatctccactgcccggatccacgcccgcgggcctgtgggagtg
gaggggctgctgaccaccaagtggatcctcgaggggcaggaccatgccgccgccgacttc
gccgagggaggtggccgcacgtggctgcacgaaaccctgccgctggactaa

DBGET integrated database retrieval system