KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7764Help
Entry
Dmel_CG7764       CDS       T00030                                 

Gene name
mrn
Definition
marionette
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:dme03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dme03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:71C3-71E5; 3L:3-42.6 cM
AA seq 499 aa AA seqDB search
MADTKSGSGRHSAAGGSGNAVLSPLGQGPANLECKDFQEYLRTRQTPESLEKLYNYPPIC
LAVFRELPEIARQFIIRILFVDQPVPQAVVTSWGAQRCAKEQAEATSCLTALNVWRVTAI
PGGLSAWELSPTFKKSVRQVLLGGGKPWPMTNTLDKDSKPRDIAFLDTYAMSRWRCVLHY
MVGTGNRNGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRAQVWHFML
QYLDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMNSQMLTFLQHLREFGLVFQRKRK
EGRFYPTRLALNVTSKEAAATASVAMDEEATQDCGYIVVETNYRVYAYTDSPLQVAVLGL
FTELLYRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAIHSKSCLP
PTVVDQIKLWELERNRFTYTEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVVQ
KNGHDDVKRYWKKYSKSGV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacgaaatccggtagtggtcggcattcggctgccgggggaagtggaaacgcc
gtcctgtcgcccttggggcagggtcctgcgaacttggagtgtaaggactttcaggagtat
ctgcgcacccgccaaacgccagagtcgctggagaagctgtacaactatccgcccatttgt
ttggccgtttttcgggagcttccagagatagcccggcagtttatcataaggatactgttc
gtggatcagcctgtgccacaagcggtggtcacatcatggggtgcccaacgttgtgccaag
gagcaagccgaggcaaccagctgcctgacggctttgaacgtctggcgggtcacagccatt
ccgggtggcctttctgcgtgggagctctcgcccaccttcaagaaaagcgtacgccaggtg
ctgctgggcggcggaaaaccttggcctatgaccaacacgctggataaggactcgaagccc
agggacattgcttttctggatacatacgccatgtcccgctggcgttgcgtgttgcactac
atggtcggcaccggaaatcgcaatggcaccgatgcggaggccattagtccggacgccgtt
cggattctgctgcacgccaatctcatgaaacgtgatgaacgagacggtatcacaataacc
cggcagggctttcagttcctgctgctggacacgcgagctcaggtgtggcattttatgcta
cagtacctggacacgtgcgaagaaagaggaatcagcctgccggaatgcttgtccatgttg
ttccagctcagtttttcaacgctgggcagggattacagttccgagggcatgaacagtcag
atgctgacattcctgcagcatctacgggagtttggactggtcttccaacgtaagcgtaag
gagggacgcttctatcccacacgtttggctctgaatgtgacaagcaaggaggcggctgcg
actgcatctgtggccatggatgaggaggccactcaggactgtggctacattgtggtggag
acgaactaccgagtgtatgcctacactgattctccgctccaggtagccgtgttaggtctg
ttcacggagcttctctaccgctttcccaatctcgtcgtgggcgtgctaacccgcgattca
gtgcgccaggcgttgcgtggcggtatcacggcagagcagattgtctcgtatctggagcag
tatgcgcatcccaatatgcgcatggtcgagtcagccattcactctaaatcctgcctgcca
cccacagtcgttgatcaaattaagctgtgggaattagagcgaaatcgcttcacctacacc
gaaggcgtgctgtacaatcagttcctctcgcatacagatttcgtaacgctacgagactac
gcccagtcgatccacatgctggtgtggcaaaatgagcgaactcgcacaatggtggtgcaa
aagaatggccacgacgatgtcaagcgttactggaagaagtactctaagagtggtgtttag

DBGET integrated database retrieval system