KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7923Help
Entry
Dmel_CG7923       CDS       T00030                                 

Gene name
Fad2
Definition
CG7923 gene product from transcript CG7923-RA (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dmel_CG7923 (Fad2)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dmel_CG7923 (Fad2)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dmel_CG7923 (Fad2)
Lipid biosynthesis proteins [BR:dme01004]
 Desaturase
  First
   Dmel_CG7923 (Fad2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:68A1-68A1
AA seq 355 aa AA seqDB search
MPRNTKDTTGVLYESDVETVDGGLSTELSNRKTTDGSKLELVWVNIVLFVILHISSLYGV
WLLFTSATWTTVVLFWPTVVVTILGVSGGAHRLWAHRTFKANTPLKLIFLFLNTLAFQDA
VYYWARDHRVHHKYTETDADPYNSQRGWFFAHIGWLCCRKHPEVVEKGKQIDLSDLEADP
LIMFQKKYYLLLMPIICFVLPTVLPMYLWGESLNVSWHVMALLRWCLSLNLIWTVNSSAH
MHGMRPYDKNICPVDQGFLIFFRVGEGYHNYHHVFPWDYKSAELGKYSQDVTTKFIEFMA
YLGWAYDLKSVSLDLVKQRVQRSGDGSHPVWGWGDKDQLKEDVGVTTITHQRNEK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcaataccaaagacaccaccggagtgctttacgaatccgatgtcgagacagta
gacggtggattgtcgacggagctaagcaatcggaagaccaccgatggaagtaaactggag
ttggtatgggtcaatatagtgctgttcgtgatccttcacatatcttcgctatatggagtc
tggctgctcttcacttcggccacgtggacaacggtcgtgctcttttggccaacggttgtg
gtgaccattttgggagtttccggcggtgcccatcgtttgtgggctcatcgcacattcaag
gcgaatacaccgctcaagctgatctttttgttcctgaacactttggcctttcaggatgcg
gtctactattgggcccgggatcatcgcgtccaccacaagtatacggaaactgatgcggat
ccgtacaattcgcaacgtggttggttctttgcccacatcggttggttgtgctgccgcaag
catccggaggttgtggagaagggcaagcaaatagatctatccgatctggaggcagatcca
ctgatcatgttccagaagaaatactacctgctgctaatgccaatcatttgctttgtcctg
cccaccgttttgcccatgtatctgtggggcgaatcactcaatgtgtcctggcacgtgatg
gccctgcttcgatggtgcctcagtctcaatctcatctggacggtcaatagctcggcccac
atgcacggcatgcggccttacgacaagaacatatgtccagtcgatcagggcttcctcata
tttttccgtgtgggtgagggataccacaactaccaccatgtctttccctgggactacaag
agcgccgagctgggcaagtattcgcaggatgtgaccaccaagtttatcgaattcatggcc
tatttgggttgggcctacgatctaaagagtgtctcactggatttggtcaagcagcgagtc
cagcgctctggcgatggatcacatcctgtttggggttggggcgataaggatcaattaaag
gaggacgtgggcgtgaccaccattacccaccagcgaaatgaaaagtaa

DBGET integrated database retrieval system