KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9520Help
Entry
Dmel_CG9520       CDS       T00030                                 

Gene name
C1GalTA
Definition
Core 1 Galactosyltransferase A (EC:2.4.1.122)
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    Dmel_CG9520 (C1GalTA)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     Dmel_CG9520 (C1GalTA)
Glycosyltransferases [BR:dme01003]
 Glycan extension
  Type 3 chain
   Dmel_CG9520 (C1GalTA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:29F5-29F5
AA seq 388 aa AA seqDB search
MTANSLLGRSILNEGRSNKRSFVSLIVGLIVGFCLAELFVYSTPERSEFMPYDGHRHGDV
NDAHHSHDMMEMSGPEQDVGGHEHVHENSTIAERLYSEVRVLCWIMTNPSNHQKKARHVK
RTWGKRCNKLIFMSSAKDDELDAVALPVGEGRNNLWGKTKEAYKYIYEHHINDADWFLKA
DDDTYTIVENMRYMLYPYSPETPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEAL
PNPKLCKSDNSGAEDVEIGKCLQNVNVLAGDSRDSNGRGRFFPFVPEHHLIPSHTDKKFW
YWQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPYGIINTPDALPNKLAVG
ELMPEIKEQATESTSDGVSKRSAETKTQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaacagtctgctaggaaggtccatactcaatgaaggtcgctcaaacaagcga
tcatttgtgtccctgattgtgggcctgatcgtgggcttctgcctggcggagctgttcgtc
tactccacgccggagcgaagtgaattcatgccatacgatggccatcggcacggcgacgtg
aacgatgcacatcacagccacgacatgatggagatgtccggaccggaacaggacgtgggt
ggacacgagcacgtgcacgagaactcgaccattgcggagcgactgtacagcgaggtgcgt
gtgctctgctggatcatgaccaatccgagcaaccatcagaagaaggcgcgccacgtgaag
cgcacctggggcaagcgttgcaacaagctgatctttatgagctccgccaaggacgacgag
ctggacgcagtggctctgcccgtaggcgagggtcgcaacaacctatggggcaagacgaag
gaggcctacaaatacatctacgagcatcacatcaacgacgccgactggttcctgaaggct
gacgatgacacatacacgatagtggagaacatgcgatacatgctgtatccgtacagtccg
gaaactccagtctacttcggctgcaagttcaagccgtacgtgaaacaaggctacatgtcc
ggcggtgccggctacgttctcagccgggaggctgtgcgtcgctttgtggtcgaagccctg
cccaatccgaagctgtgcaagtcggataactcgggtgctgaggacgtggagattggcaaa
tgtctgcagaatgtaaacgtgctcgctggggactcgcgagactcaaacggtcggggtcgc
ttctttccatttgtgcccgagcaccatctgattccatcgcacacggacaagaagttctgg
tactggcagtatatcttctacaagacggatgagggacttgactgctgctcggacaacgcc
atatcgttccactacgtctcccccaatcaaatgtatgtgctggattatctgatctaccat
ctgagaccgtacgggatcataaacacacccgatgcgttgccgaataagctagccgtgggc
gaactgatgccggagatcaaggagcaggcgacggaaagcacaagtgatggggtctccaag
agatccgccgagacaaagacgcaataa

DBGET integrated database retrieval system