KEGG   Drosophila mojavensis: Dmoj_GI11591Help
Entry
Dmoj_GI11591      CDS       T01062                                 

Definition
GI11591 gene product from transcript GI11591-RA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dmo  Drosophila mojavensis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Dmoj_GI11591
Enzymes [BR:dmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     Dmoj_GI11591
Glycosyltransferases [BR:dmo01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Dmoj_GI11591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 901 aa AA seqDB search
MSSHSVQRRKTARSKSKQKQQQQPANVAENLIDKQNASNEQNERLHFRSRSATSTAPSTA
AAAVPLSCISPSPLCCNGILPTSAVSAMLNCCRDINCHLNSPLRGSVERSQRSESRQSFL
TSETITRTTSSPTPTSTSKQSRSRSRSHSHSSSRSSSCSVGDNPHKQREGSAAGADRVGR
AQLTVSLHIDLISWGLFVLAFITRFYKLATPAHVVFDELHFGKYISLYMRNIFFFDQHPP
LGKQLIAGLVSFAGYDGNYTFTRIGAPYGPNVPVFWLRFLPALCGSLLAPAVYHLLLEAR
LRRWSAALGGLLVVLDNALLTQSRFILMESMLLLASTVGISFLLRFQRCSLGSLKWLSSG
AAAALFLACAGCIKYVGFFAMGLAGYLLCRHLWKLLYDATLTNKQLWMHALSRVFLFVGI
PLAVYLGVFYIHLRTLHRAGPHDTIMTSAFQASLDGGLASITRGQPLAVVHGSQITLRHT
HGRTCWLHSHAAVYPVRYKDNRGSSHQQQVTCYSFKDVNNWWIVKRPERDDLVVGDQPDA
IKHGDVIQLVHGITSRALNSHDVAAPMTPQCQEVSCYIDYEIKMAGELLWRVEILNRQSE
GDYWHAIKSEIRLIHETTGAALRFSGRQLPSWGYNQHEVVADRERQHQDAIWNVEEHRYT
KTQDQRERERQLLSAEMIPTHRTKLSFWSKLLELQTKMLWHAKQLQSHMYSSLPHEWPLL
DKGIAYWLDDSSSAQIYLLGNVLIWYVASAGLVLYAALLVFYALRRRRLCFDISASEWRR
FLSAGDTFFVGYLVHYLPYFFMDRTLFLHNYLPAFAFKLLLLSFVLDHVDYLLRRHCSGR
AVHLVRLYRLLLIVWLVAAAATFFKFLPLSYGSRKMSAKEIIDLRWKDTWDFILQKNYAL
H
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccacagcgtgcaacggcgcaaaacagcgcgctccaagtcaaagcaaaaacaa
caacaacagccagctaatgttgcggaaaacctcatcgacaaacaaaacgccagcaatgaa
caaaacgaaagacttcactttcgcagccgttcagcaacctcaacagcgccgtcgacggca
gcagcggcagtgccactcagctgcatttcaccttcaccattgtgctgtaatggaatactg
cccaccagcgcggtctcagccatgctaaactgttgccgcgacatcaactgccatttgaat
tcaccactgcgcggcagcgttgagcgcagtcaacgctcagagagccgacaatcatttcta
acttcggagacgataacaagaacaacatcttcgcctacacctacctctacatcaaaacaa
tcgcgttctcgttctcgttcccattcccattccagttcccgttcgtcttcgtgtagtgtc
ggcgacaatccgcacaagcagagggaaggcagcgcagctggcgcggacagagttgggaga
gcgcaattaaccgttagcctgcacatcgatctcatcagctggggtctgttcgtgctcgca
tttattacgcgattctataagctcgcaacgcccgcgcatgttgttttcgatgagctgcac
tttggaaaatacatttcgctatatatgcgcaacatcttcttcttcgatcagcatccgcca
ctgggcaagcagctgatagctggcctggtcagcttcgctggctacgacggcaactacaca
ttcacacgaatcggcgccccctatgggccgaatgtgcccgtcttctggctacgctttctg
cccgctctctgtggaagtctgctcgcgccggcagtgtaccatctgctgctggaagcgcgg
ctgcgtcgctggtcggcagcgcttggcggcttgctcgtcgtgctggacaatgcgctgctc
acgcagtcgcgcttcattctcatggaatctatgctgctgctggccagcactgtgggcatt
agcttcctgctgcgcttccagcgctgctcgctgggcagcctcaagtggctgagcagcggc
gcggcagctgcgctgtttctagcctgcgctggctgcatcaaatatgttggcttttttgcc
atgggacttgcgggctatttgctgtgtcgccatctctggaagctgctctacgatgcgact
ttgacaaataaacaactgtggatgcacgccttaagcagagtgtttctgttcgtgggcatt
cccttggccgtttacctgggcgtcttctacattcacttgaggacgctgcatcgagcgggg
ccacacgacacgatcatgacgagcgccttccaagcctcgctggatggtgggctggcctcg
atcacgcggggtcagccgctggctgtggtgcacggatcgcaaattacgctgcggcacacg
cacggacgcacctgctggctgcactcgcacgcagcggtgtatcctgtgaggtataaggat
aatcgcggctcttcgcatcagcagcaggtgacatgctactccttcaaggacgtgaacaac
tggtggattgtgaagcgaccggagcgtgatgatctggtagtgggcgaccagccggatgcc
atcaaacatggcgatgtcatccagctggtgcacggcatcactagccgtgctctcaactcc
cacgacgtggctgccccaatgacgccccagtgccaggaggtcagctgctacatagactac
gagatcaagatggccggcgagttgctgtggcgcgtggagatcctcaaccggcagtccgag
ggtgactactggcatgcgatcaagtcggagatacgattgatacacgagaccacaggcgcg
gcgctgcgcttcagtggacgacagctgcccagctggggctacaatcagcacgaggtggtg
gccgatcgcgagaggcagcatcaggacgccatctggaatgtggaggagcatcgctacacc
aagactcaggatcagcgggagcgagagcgtcaactgctctccgccgagatgattcccaca
caccgcaccaagctctccttctggtccaagctgctggagctgcagaccaagatgctgtgg
cacgccaagcagctgcagagccacatgtacagctcgctgccgcacgagtggccgctgctg
gacaagggcatcgcctactggctggacgacagctccagcgcccaaatctatttgctgggc
aacgtgctcatctggtatgtggccagtgctgggctcgtcctctatgccgcgctcctcgtg
ttctatgccttgcggcgccgtcgcttgtgcttcgatatctcggccagcgagtggcggcgc
ttcctcagcgctggggacactttctttgtgggctatctggtgcactatttgccgtacttc
ttcatggatcgcacgctcttcctgcacaactacttgccggcgtttgcctttaagctgctg
ctcctcagctttgtgctggatcatgtggactatttgctgagacgccattgcagcggacgg
gccgttcacttggtgcgcctctatcgtctactgctgatcgtctggctggtcgcagccgca
gcgacctttttcaagttcttgccattgagctacggctcacgaaagatgtctgccaaggag
attattgacctgcgctggaaggacacctgggactttatactgcagaagaactatgcattg
cattaa

DBGET integrated database retrieval system