KEGG   Drosophila mojavensis: Dmoj_GI16594Help
Entry
Dmoj_GI16594      CDS       T01062                                 

Definition
GI16594 gene product from transcript GI16594-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dmo  Drosophila mojavensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dmo00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dmo00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dmo00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dmo00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dmo00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dmo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 603 aa AA seqDB search
MRCAALAMVALLAFGWTPGLGDALGADDLIYGYECSKGLCRKVELSEENFASAISLPVCR
LFCGSDIGTLWPKPTGVVQLEPLMRQVDVANIEFQMPGTKDKLWKSTEQRWLDLLEAKVP
NRKILKKGGYQLNIIVNTADAGAPMRLQLNTDESYALSIGSNSAGQVTANITANSFFGAR
HGLETLSQLIVYDDIRREVQVVANASIADAPFYKWRGLLLDTSRNYYSVKAIKRTLDGMA
MVKLNTFHWHITDSHSFPLEISKRPELSKLGAYSPSKVYTHSDVEDIVEYGRVRGIRVMP
EYDSPAHVGEGWQHKNMTACFNAKPWNDYCVEPPCGQLDPTVDDMYNVLEDIFSDMFKLY
NPDVFHMGGDEVSVACWNSSASIRNWMLERGWNLKEEDFMRLWGHYQMEALSRVDRVANG
SHTPIILWTSTLTDERYIDQYLDPARYIIQIWTKGNDRVIKKILKRGYRIIASNYDALYF
DCGGGGWVNDGNNWCSPYIGWQKVYQNDLAQIAGDYKHHVLGAEAAVWSEQIDEYTLDNR
FWPRASALAERLWSNPTEGWRQAESRLLLHRERLVENGIGAEALQPQWCLQNENECPVDA
YDP
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgtgcggcgttggcaatggtagcgctgctggcctttggctggacgccaggtctg
ggcgatgctctgggagctgacgatttgatatacggctacgagtgtagcaagggactatgt
cgaaaggtcgagctgagtgaggaaaattttgcttcggctattagtttgccagtttgccgg
ctgttctgtggcagcgacattggcactctctggcccaagccaacgggcgtggtgcaactg
gagccgctgatgcgacaggtggacgtagccaacattgaattccagatgccaggtacaaaa
gataaactgtggaagtcaacggaacagcgttggctagacctgttggaggcgaaggtacca
aatcgcaagatcctcaagaaaggcggctaccaattaaatattattgtcaatactgcggac
gcaggggcaccaatgcgtctccagctgaacacggacgagagctatgcactgagcatagga
tcgaatagcgctggccaagtgacggccaatattacagctaacagcttttttggagcacgt
catggcttggagactttgagccagttgattgtctatgacgatatccgccgggaggtgcaa
gtggtggccaatgcctctattgcggatgcacctttctacaagtggcgtggacttttgctg
gatacctcgaggaactactactctgtaaaagccatcaagcgaacattagatggcatggcc
atggtcaagctgaacaccttccactggcacatcacggactcgcatagctttccactggaa
atcagcaagcgaccagagctctccaaactaggcgcctattcaccaagcaaagtgtacaca
cacagcgatgtagaggatatagtggagtatggacgagttcggggtatacgtgtaatgcca
gagtacgacagtccggcgcatgtgggcgagggctggcagcacaagaacatgacggcttgc
ttcaatgcaaagccttggaatgattattgtgtggaacctccatgcggccagctggacccc
actgtagatgacatgtacaatgtgttggaagacatattcagtgatatgtttaagctttac
aatcctgatgtctttcatatgggcggcgatgaagtatccgttgcttgctggaacagcagt
gcaagcatacgcaactggatgctggagcgtggctggaatttgaaggaggaagatttcatg
cgcctgtggggccactatcaaatggaagctctcagtcgtgtggatcgtgtggccaatggg
tcgcatactcccattatcctgtggaccagcacactcaccgatgagcgctacatcgatcaa
tatctggatccagcccgttatatcatacaaatctggactaagggcaatgacagagtgatc
aagaagatattgaagcgtggctatcgcatcattgcgtccaactacgatgctttgtatttc
gattgcggcggcggtggctgggtgaatgacgggaacaattggtgttcgccctatattggc
tggcagaaggtctatcagaatgatttagctcaaattgcgggcgattataaacatcatgtg
ctgggcgccgaggctgccgtttggtcagagcaaatcgatgagtataccttggataatcgc
ttctggccacgagccagtgccttggccgaacgtctttggtcgaatccaactgaaggttgg
cgacaggccgagtcgcgtttgctcctgcatcgcgagcggctggtcgagaatggtatcgga
gcggaggcattgcagccgcaatggtgcctgcagaacgagaacgaatgtcccgttgatgcg
tatgacccatag

DBGET integrated database retrieval system