KEGG   Drosophila mojavensis: Dmoj_GI19176Help
Entry
Dmoj_GI19176      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform E
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00061  Fatty acid biosynthesis
dmo00620  Pyruvate metabolism
dmo00640  Propanoate metabolism
dmo01100  Metabolic pathways
dmo01212  Fatty acid metabolism
Module
dmo_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dmoj_GI19176
   00640 Propanoate metabolism
    Dmoj_GI19176
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Dmoj_GI19176
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    Dmoj_GI19176
Enzymes [BR:dmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Dmoj_GI19176
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Dmoj_GI19176
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Dmoj_GI19176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp ATP-grasp_3 MetallophosN GCV_H
Motif
Other DBs
NCBI-GeneID: 6579371
NCBI-ProteinID: XP_002005267
FlyBase: FBgn0141915
UniProt: B4KQ74
Position
Unknown
AA seq 2461 aa AA seqDB search
MLIAFFITLAFIAFLLNLLFARQREITPIPTNNNNSNNNNNNNSSVIAATAATSATAKGS
DQQQQQQQQQQQQQQQKQQRFPKSCIKKVKFSSESLKTDVDGLCEQLKESSVLSDLNNFH
INNNNNNNNDIDNKYNNKMSEQEATTSGETTQATPTDGDRPSFLVGDEIDEKEAIEAGDQ
FPQKMQSDICQNGDIAERRKRLRPSMSRTGLGQDRHQDRDFHIATTEEFVKRFGGNRVIQ
RVLIANNGIAAVKCMRSIRRWSYEMFKNERAVRFVVMVTPEDLKANAEYIKMADHYVPVP
GGSNNNNYANVELIVDIALRTQVQAVWAGWGHASENPKLPELLHKEGLVFLGPPERAMWA
LGDKVASSIVAQTAEIPTLPWSGSDLKAQYSGKRIKISSDLFARGCVTNVEQGLAAVAKI
GFPVMIKASEGGGGKGIRRVDTAEEFPALFRQVQAEVPGSPIFVMKLASGARHLEVQLLA
DQYGNAISLFGRDCSIQRRHQKIIEEAPAIVAQPEVFEDMEKAAVRLAKMVGYVSAGTVE
YLYDPEGRYFFLELNPRLQVEHPCTEMVADVNLPACQLQIGMGIPLYRLKDIRLLYGESP
WGSSVIDFENPPNKPRPSGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVA
ASGGLHEFADSQFGHCFSWGENRQQARENLVIALKELSIRGDFRTTVEYLITLLETNRFL
DNTIDTAWLDALIAERVQSEKPDIILGVMCGALHIADRQITQAFSSFQTSLEKGQIQAAN
TLTNVVDVELINGGLRYKVQAAKSGPNSYFLLMNNSFKEIEVHRLSDSGLLISFEGASYT
TYMREEVDRYRIVIGNQTCVFEKENDPSLLRSPSAGKLINMLVEDGAHVNKGQAFAEIEV
MKMVMTLTSQEAGTVTFVRRPGAVLDAGSLLGHLELDDPSLVTKAQPCKSQFPQPENPPV
PEKLNRVHSTYKSILENTLAGYCLPEPYNAQRLRDIIEKFMQSLRDPSLPLLELQEVIAS
ISGRIPISVEKKIRKLMTLYERNITSVLAQFPSQQIASVIDSHAATLQKRADRDVFFLTT
QSIVQLVQRYRNGIRGRMKAAVHELLRQYYDVESQFQHGHYDKCVGLVRERNKDDMLTVV
NTIFSHSQVAKKNLLVTLLIDHLWANEPGLTDELANTLSELTSLNRAEHSRVALRSRQVL
IAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQRLILSETSIFDILHDFFYHSNRAV
CNAALEVYVRRAYTSYDLTCLQHLELSGGLPLVHFQFLLPTAHPNRLFSRMSSPDGLDQA
AAETMGSSFVRTGAIAAFDSFEHFSMYSDEILDLLEDFVSPAMCNAKVLEAVEAADSISD
SRHSTSINVSLSDPITRANAAEEAKSTEPIHIISVAVRETGEMDDVQMSQIFGNYCKEHN
EELYQRRIRRITFAALKKRQFPKFFTYRARDNFEEDRIYRHLEPASAFHLELNRMKTYDL
EALPTANQKMHLYLGRAKVSKGQEVTDYRFFIRSIIRHSDLITKEASFEYLQNEGERVLL
EAMDELEVAFSHPHAKRTDCNHIFLNFVPTVIMDPAKIEESVTKMIMRYGPRLWKLRVLQ
AELKMVIRQSPQSPTQAVRLCIANDSGYFLDISMYTEQTEPETGIIKFHAYGDKQGSLHG
HPISTPYMTKDFLQQKRFQAQSNGTTYVYDVPDMFRQMTERHWREFSKARPTVDIRIPDK
ILLECKELVLENDTLVELQRLPGENNCGMVAWRIVLATPEYPAGREIIVIANDLTYLIGS
FGIKEDVLFAKASQLARQLKVPRIYISVNSGARIGLAEEVKAMFKIAWEDPEEPDKGFKY
LYLTTEDYAKVANLNSVRAILIEDEGEQRYKITDIIGKDDGLGVENLRYAGLIAGETSQA
YEEIVTIAMVTCRTIGIGSYVVRLGQRVIQIDNSHIILTGYAALNKLLGRKVYASNNQLG
GVQIMYNNGVTHKTEAIDLDGVYTILDWLSYIPAYIGCDLPIILPSDRIDRPVDFMPTKS
PYDPRWMLAGRVNPANANEWENGFFDRDSWSEIMAPWAKTVVTGRARLGGVPVGVIAVET
RTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFS
GGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETYAD
PEARGGVLEPEGIVEIKYKEKDLIKTIHRLDGTTIGLKREYDEAIAAGDKVKAAQLDEKI
KARIAVLMHVYHTVAVHFADLHDTPERMLEKECISEIVPWRESRRWLYWRLRRLLLEDAY
IKKILRAQDNLSVGQAKQMLRRWLVEEKGTTEAYLWDNNEEMVNWYQEQSNSESIVSKNV
NSVKRDAIISTISKMLEDCPDVALDAVVGLCQGLTPVNRGVVVRTLAQMQLNEESSANTQ
G
NT seq 7386 nt NT seq  +upstreamnt  +downstreamnt
atgcttatcgcattttttatcactctggcgtttattgcatttctcttgaatttgctcttt
gcgcgccaaagagaaataacaccaattccaactaacaacaacaacagcaacaacaacaac
aataacaactccagtgttattgcggctacagcagcaacgtcggcaacggcaaagggcagc
gaccaacaacaacagcagcagcagcagcagcagcaacaacaacagcaaaagcaacaacgt
tttcctaagtcctgcataaaaaaagtgaaattctctagcgagagcctcaaaacggatgtt
gatggactgtgcgagcagttgaaggagagcagcgttctaagcgacttgaataattttcat
ataaacaataataataacaataacaacgacattgacaacaaatacaataacaagatgagt
gaacaagaggcaacgacaagcggcgagacgacacaagccacgcccacagatggcgatcgt
cctagttttttggtgggcgatgaaatcgatgagaaggaggcaatcgaagccggcgatcaa
ttcccgcagaaaatgcaaagcgatatttgtcaaaatggcgacatagcagagcgacgcaag
cgtctaagacccagcatgtcgcgcactggtctcggccaggatcgccatcaggatcgcgac
tttcatatcgccacgacggaggagtttgttaagcgtttcggcggcaatcgcgttatccag
cgggttctgattgccaacaatggcattgcggctgttaagtgcatgcgctcgatacgtcgc
tggtcctacgagatgtttaagaacgagcgggcggtgcgatttgtggtgatggtgacgccc
gaggatctgaaggccaatgccgaatatattaagatggctgatcattatgttccggtgccc
ggtggctccaacaacaataactatgcgaatgttgagctaattgtggatattgcacttcgc
acacaagttcaggccgtgtgggcgggctggggtcatgcatcggagaatcccaaattgccg
gagctgttgcacaaggagggcctcgtcttcctgggtccgccagaacgtgcgatgtgggcg
ttgggcgacaaggtggcctcatcgattgtggcccaaacagctgaaatacccactttgccg
tggtccggctcagacctgaaggcgcaatacagtggcaaaaggattaaaatttccagtgac
ctctttgcccgtggctgtgtcaccaatgtggagcagggactggctgctgtggccaagatt
ggctttccggttatgattaaggcttcggagggcggcggcggcaagggcattcgtcgcgtg
gacaccgctgaggagtttccggctctgttccgtcaggtgcaagccgaggtgcccggctcc
cccatctttgtcatgaagctggcaagcggtgcacgccatttggaggtccaactgctggcc
gatcaatatggcaatgccatcagcttgttcggacgtgattgttccatacagcgccgtcat
cagaagatcattgaggaggcgcctgccatcgtggctcagccggaggtcttcgaggacatg
gagaaggcggccgtgcgcttggccaaaatggttggctatgtgagcgccggcactgtggaa
tatctgtacgatcccgagggcaggtatttcttcctggagctcaatccacgtctgcaggtg
gagcatccttgcacggagatggtagccgatgtcaatttgcccgcttgtcagctccaaatt
ggaatgggcattcccctctatcgattgaaggatattcgcttgctctatggcgagtcgcct
tggggctcttccgtcattgactttgagaatccaccgaataagccacgcccctcgggccac
gtcattgccgctcgcatcacctccgagaatcccgacgagggcttcaagcccagttccggc
accgtgcaggagctcaacttccgctccagcaagaacgtctggggctacttcagtgtggct
gcatccggtggcttgcatgagttcgctgattcgcagttcggacattgcttctcctggggc
gagaatcgtcagcaggcacgtgagaatcttgtgattgctctcaaggagctgtccattcgc
ggtgatttccgtacaacggttgaatatctgattacgctgctcgagacgaatcgtttcctg
gacaataccatagacaccgcctggctggacgcgctgatcgcggagcgtgtgcaatccgag
aagccggacattattctgggtgtcatgtgtggtgccctgcacatcgctgatcgccagata
actcaggcattctccagcttccagacctcactggagaagggtcaaatccaggcggccaac
acgctgaccaacgtggtggacgtggagctgattaatggcggcttgcggtacaaagtgcaa
gcagccaagagtggacccaattcctatttcctgctcatgaacaactcgttcaaggagatc
gaagtgcatcgactgtcggacagtggactgctcatctcgttcgagggcgcttcgtatacc
acctatatgagagaggaggtggatcgctatcgcattgtcattggcaatcaaacgtgcgtc
tttgagaaggagaatgatccatcgctgctgcgcagtccctcggctggcaagctgatcaat
atgcttgtcgaggatggcgcccatgtgaacaagggtcaggcattcgctgagatcgaagtc
atgaaaatggttatgaccctgacctcccaggaggcgggcactgtgacctttgtgcgacgt
cctggcgctgtgctcgacgctggctcgctgcttggccatttggagctggatgatccgtcg
ctggtgaccaaagcgcagccctgcaaaagccaattcccccagccggagaatccgccagtg
ccagagaaattgaatcgcgtgcacagcacctacaagagcatcctcgagaacacgctggcc
ggctattgtctgccagagccctacaatgcccagcgactgcgcgacataattgagaagttc
atgcagagtttgcgtgatccttcgctgccgctgctcgagctgcaggaggtgattgcttcg
atatccggacgcatacccatttccgtggagaagaagatacgcaagctgatgacgctctac
gagcgcaacatcacgagtgtcctggcccaattcccctcacagcaaatcgcgagtgtgatc
gatagccatgcagcgacgctgcagaagcgcgccgatcgtgatgtcttcttcctgaccacc
cagagcatcgtgcagctggtgcagcgctacaggaatggcattcgaggacgcatgaaggcc
gccgtccacgagctgctgcgtcagtactacgacgtggagtcgcagttccagcatggacac
tacgacaagtgcgtgggtctggtgcgagagcgcaacaaggacgatatgttgacggtggtt
aatacgatattctcgcactcgcaggtggccaaaaagaatctattggtcacgctgctcatc
gatcacctgtgggccaacgagccgggcctcaccgacgaactggccaatacgctgagcgag
ctgacctcgctcaatcgagcggaacactcacgtgtggccttgcgctcccgccaggtgctc
attgctgcccatcagccggcctacgagctgcgtcacaatcagatggagtccatcttcctg
tcggctgtcgatatgtacggtcacgatttccatcccgagaacttgcagcgcttgatcctg
tcggagacatccatctttgacatactccatgacttcttctatcactccaatcgggctgtc
tgcaacgccgccctcgaggtctatgtgcgacgtgcctacacctcctatgacctgacctgt
ctgcagcacttggagctctccggtggcttgcccctggtgcatttccaattcctgttgcca
acggcgcatccgaatcgcttgttctcgcgcatgagctcgccggatggcctggatcaggcg
gctgccgagacgatgggcagctcatttgtgcgcacgggcgcgattgcagcattcgattcg
ttcgagcatttctccatgtactcggatgagatactcgatctgctggaggatttcgtgtcg
ccagcaatgtgcaatgctaaggtcttggaggctgtcgaggcagcggactctatttcggat
agtcgtcacagtacctcgatcaatgtctccctctcggatcccatcacgcgtgcgaatgct
gccgaagaggccaagtccacggagcccatccacatcatcagtgtggctgtgagggagacc
ggggaaatggacgatgtgcaaatgtcgcagatctttggcaactattgcaaggagcacaac
gaggagctgtaccagcgacgcatacgtcgcatcacctttgcggcgctcaagaaacgccag
ttccccaaattctttacgtatcgagcccgcgacaatttcgaggaggatcgcatctatagg
catttggagccagcatcggctttccatttggagctgaatcgcatgaagacctacgacctg
gaggcgttacccacggccaaccagaaaatgcatttgtatttgggcagagctaaggtatcg
aagggtcaagaggtgaccgactatcgcttcttcatacgttccattatccgtcactccgac
ctgattaccaaagaggcctcattcgagtatctgcaaaatgagggcgaacgtgtgctgctc
gaggcaatggatgaactggaggttgccttctcccatccccatgccaagcgcaccgattgc
aatcacatattcctcaactttgtgcccacggtcatcatggatccggcgaaaatcgaggag
tccgtgacaaagatgatcatgcgctatggtccacgtttgtggaagctgcgcgtgttgcaa
gctgagctgaagatggtcattcggcagtctcctcaatctcccacccaagccgtgcgtctc
tgcattgccaacgactcaggctacttcctggacatctccatgtacacggagcaaactgaa
cccgaaacgggcattatcaagttccatgcctatggcgataagcagggctctctgcacggt
catcccatttccacgccctacatgaccaaggactttttgcagcagaaacgcttccaggcg
caatcgaatggcaccacctatgtctacgatgtgcccgatatgttccgccagatgaccgag
cgtcattggagagagttctccaaggcacgacccactgtcgacatacgcatacccgacaag
atattgctggagtgcaaagagttggtcttggagaacgatacgctagttgagctacagcgt
ctgccaggcgagaataattgcggcatggttgcttggcgcattgtgctggccacgcccgag
tatccagctggtcgtgagattatagtgattgccaatgacttgacctatctgattggctcc
tttggcatcaaggaggatgtgctctttgccaaggcctcgcaactggcgcgacagctcaaa
gtgcctcgaatctatatttctgtcaacagcggcgcacgcattggcctcgctgaggaggtg
aaggccatgttcaagatcgcatgggaggatccagaggagccagacaagggcttcaagtat
ctatacttgaccactgaggactatgccaaggtagcgaatctgaattcggtgcgtgcaata
ctcatcgaggatgagggcgaacagcgctacaagattacggatatcattggcaaggacgat
ggcttgggcgttgagaatttgcggtatgctggtttgattgccggtgaaacatcccaggcg
tatgaggaaatcgtaaccattgccatggtcacctgtcgcaccatcggcatcggctcctat
gtggttcgtcttggccagcgtgtcatacagattgataattcgcacattatactcacgggc
tatgcggccttgaataagctgctcggtcgcaaggtctatgcctccaataatcagcttggt
ggcgtccagatcatgtataataatggtgtcacgcacaaaacggaagccatcgacttggat
ggcgtttacacaattctcgactggctctcttacattcccgcttatattggctgcgatctg
cccattatattgcccagtgatcgcattgatcgccccgttgattttatgcccaccaaatcg
ccttatgatccacgctggatgctcgctggccgtgtgaatcccgccaatgccaacgaatgg
gagaacggtttctttgatcgtgattcatggagcgaaattatggcgccctgggccaagaca
gtggtcacgggacgtgcccgtttgggtggtgtgccagttggcgttatagccgtagagacg
cgcaccgtggaggtggagatgcccgcggatcccgcgaatttggattcggaagccaagaca
ctgcagcaggctggccaggtttggtatcccgactcgtcctacaagacagcgcaggcaatc
aaagatttcggacgcgaagagctgccattgattgtgtttgccaactggcgtggtttctcc
ggcggcatgaaggacatgtatgagcagattgtgaaattcggtgcctacattgtcgacgga
ctgcgcgagtacaagaagccggtgctcatctatttgccacccaatgctgagctgcgtgga
ggtgcctgggctgtgcttgactctctgatcaatccgcgttacatggaaacctatgccgat
ccagaggcacgcggcggtgtgctcgaaccagagggcattgtcgagatcaagtacaaggag
aaggatctgatcaagactatacatcgcctggatggcaccaccattgggctgaaacgcgag
tatgacgaggccatcgccgctggtgataaggtcaaggccgcacaactggatgagaagatt
aaggcgcgcattgcagtgctgatgcatgtgtatcacactgtcgccgttcactttgccgat
ctgcacgatacgcctgagcgcatgctggaaaaggaatgcataagcgaaattgtcccctgg
cgcgaatcgcgtcgctggctctactggcgtctgcgtcgactgctgctcgaggatgcgtat
atcaagaagatcttacgcgcacaagacaacctctcggtgggtcaagccaagcagatgctg
cgtcgctggctggtcgaggagaagggcaccacagaggcctatttgtgggacaataatgag
gaaatggtcaactggtaccaggagcaatcaaatagcgaatcgattgtgtccaaaaatgtc
aactctgtgaagagggatgccattatctccacaatatccaaaatgctcgaggactgtccg
gatgtggccctggacgctgtcgttggtctctgccaaggattgacgcccgtgaatcgtggc
gtggttgtacgcaccttagcgcaaatgcagctgaatgaggagtcctctgcgaatacccaa
ggatga

DBGET integrated database retrieval system