KEGG   Drosophila mojavensis: Dmoj_GI23550Help
Entry
Dmoj_GI23550      CDS       T01062                                 

Definition
GI23550 gene product from transcript GI23550-RA
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dmoj_GI23550
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: Other group
  Aur family [Table]
   Dmoj_GI23550
Protein phosphatases and associated proteins [BR:dmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dmoj_GI23550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 366 aa AA seqDB search
MAMQKKQLLTKKPTTENVAPSGSKTSAQFAKPLTKPAIGSQQKQQNTAAAPVAEAKKYAN
PAVSNNEKQAPTSATASSSSSSSSNTNTEKDKTESATAKPKKTWALSNFDIGRQLGRGKF
GNVYLAREKESQFVVALKVLFKRQIGETKVEHQVRREIEIQSHLRHPHILRLYAYFHDEA
RIYLVLEYAPQGTLFSALQAQPMKRFDDRQSATYIKALCSALLYLHERDIIHRDIKPENL
LLGHKGVLKIADFGWSVHEPNSMRLTLCGTVDYLPPEMVLNKPHTKNVDLWSLGVLCFEL
LVGHAPFFSKTYEETYQKILKVDYKTPEHVSKAAAHLISKLLVLNPMHRMPLDQIMLHPW
IVAHTQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcagaaaaagcaattgctaacaaaaaagccaacgactgaaaatgtggcgcct
agtggcagcaaaactagcgcacaatttgcaaaacctctaacgaagcccgcgattggctca
cagcaaaaacaacaaaatactgcagcggctcctgtagcggaagctaaaaaatatgcaaat
cctgctgtgtctaacaatgaaaagcaagctccgacatcagccactgcgagtagcagcagc
agcagcagcagcaacaccaacactgaaaaggataagactgaatcagcgacagccaaaccc
aaaaagacttgggcgctaagtaactttgacattggtcgccagctgggacgtgggaaattt
ggcaacgtgtatttggctcgcgaaaaggaatcccaatttgtcgttgcactgaaagtcctt
ttcaagcgtcaaattggtgagaccaaggtcgagcatcaggtgcgacgcgaaatcgaaatt
caatcgcacctgaggcatccacatatcttgcgtctgtatgcctattttcatgacgaggca
cgcatctatttggttttggagtatgctccccaaggaacgctgttcagcgcactgcaggcg
cagccaatgaaacgcttcgatgatcgccagtcggccacttatatcaaggccctctgctca
gcgctgttgtacttgcatgagcgcgatatcattcatcgggatattaagccggagaatctg
cttctgggccacaaaggagtgctgaagatagccgatttcggttggtccgtgcatgaaccg
aactcgatgcgtctgaccctttgcggcacggttgactacttgccacccgaaatggtgcta
aacaagccgcataccaagaatgtagatctttggagcttaggtgtgctctgctttgaactg
cttgtgggtcatgcgccgttcttttcaaagacctatgaagagacctatcaaaagatactt
aaagtggattacaaaacaccggagcacgtctcgaaagctgcggctcatttaatctccaag
ctcttagtgctaaatcctatgcatcgaatgccactggatcagattatgttacatccatgg
attgtggcgcacactcagtga

DBGET integrated database retrieval system