KEGG   Desulfosporosinus orientis: Desor_4592Help
Entry
Desor_4592        CDS       T01675                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00010  Glycolysis / Gluconeogenesis
dor00020  Citrate cycle (TCA cycle)
dor00620  Pyruvate metabolism
dor00633  Nitrotoluene degradation
dor00640  Propanoate metabolism
dor00650  Butanoate metabolism
dor00680  Methane metabolism
dor01100  Metabolic pathways
dor01120  Microbial metabolism in diverse environments
dor01130  Biosynthesis of antibiotics
dor01200  Carbon metabolism
Module
dor_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desor_4592
   00020 Citrate cycle (TCA cycle)
    Desor_4592
   00620 Pyruvate metabolism
    Desor_4592
   00640 Propanoate metabolism
    Desor_4592
   00650 Butanoate metabolism
    Desor_4592
  Energy metabolism
   00680 Methane metabolism
    Desor_4592
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desor_4592
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desor_4592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_7 Fer4_16 Fer4_9 Fer4_8 Fer4_2 Fer4_10 Fer4_21 Fer4_4 Fer4_15
Motif
Other DBs
NCBI-ProteinID: AET69997
UniProt: G7WC23
Position
complement(4787954..4788238)
Genome map
AA seq 94 aa AA seqDB search
MVKNLPVVPTAKAGSLVETPTGITWRIQYPVILETCQMCLDCTLYCPDGALAQYNEKVVL
NLSLCKGCGICANECKENAIQMIPEYSGVQGVFR
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
ttggttaaaaatcttccagttgttccaacggctaaagcaggcagcctagttgagacgcca
acgggaataacttggcgtattcaatatccagtgattttagaaacatgccaaatgtgcttg
gactgtacattgtattgcccggatggggccttagctcagtataatgaaaaggttgttctt
aacttaagtttgtgtaaagggtgcggaatttgtgccaatgaatgtaaagagaatgccata
caaatgattcctgagtattctggggttcagggtgttttccgttaa

DBGET integrated database retrieval system