KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0558900-01Help
Entry
Os09t0558900-01   CDS       T02163                                 

Gene name
Os09g0558900
Definition
Similar to NADPH-cytochrome P450 reductase (Fragment).
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr09:complement(join(22217718..22218080,22217578..22217637,22217401..22217477,22217221..22217278,22217047..22217130,22216929..22216965,22216330..22216399,22215981..22216175,22215807..22215899,22215468..22215696,22215292..22215375,22215072..22215223,22214898..22214994,22213891..22214040,22213735..22213812,22213304..22213426,22213108..22213221,22212751..22212831))
AA seq 714 aa AA seqDB search
MDSGGGGGGGALRPSALDLVAALLTGRGRPEEEGWPPSLAENRHLIVLLTTSLAVLVGCG
VALLVRRSSISAPAVRAQEPQPRAPAPAKRKQEAEPDPDDGRQRVAVFFGTQTGTAEGFA
KALAEEAKSRYDKAVFKVLDLDEYAADDEEYEQKLKKEIIALFFVATYGDGEPTDNAARF
YKWFGEGNERGEWLSNLRFGVFGLGNRQYEHFNKVGKVVDQLLAEQGGKRIVPLGLGDDD
QCIEDDFNAWKELLWPELDKLLRVEDDKSAAPTPYTAAIPEYRVVLVKPEEAMHINKSFS
LSNGHAVYDIQHPCRANVAVRRELHTPASYRSCIHLEFDISGTGLTYETGDHVGVYAENC
TETVEEVENLLGYSPDTLFSIHADQEDGTPLFGGSLPPPFPSPCTVGTALARYADLLSFP
KKSALIALASHASDPKDAERLRHLASPAGKKEYSQWIVSSQRSLLEVMTEFPSAKPPLGV
FFAAIAPRLQPRYYSISSSPRMTPTRIHVTCALVYGQTPTGRIHKGVCSTWMKNSIPLEE
SQECSWAPIFVRQSNFKLPTDPTVPIIMIGPGTGLAPFRGFLQERLALKETGVELGHAVL
FFGCRNRKMDFIYEDELNNFVETGALSELIVAFSREGPSKEYVQHKMAEKAPEIWSIISQ
GGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTESYVKSLQMEGRYLRDVW
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggactccggcggcggcggcggcggcggggcgctgaggccgtcggcgctggacctggtg
gcggcgctgctcacggggcggggacgaccggaggaggaggggtggccgccctcgctcgcc
gagaaccgccacctcatcgtcctgctcaccacctccctcgccgtcctcgtcggctgcggc
gtcgcgctgctcgtccgccgctcctccatctccgcgcccgccgtgagggcgcaggagccg
cagccgcgggcccccgcccccgcgaagaggaagcaggaggccgagcctgaccccgacgac
ggcaggcagagggtcgccgtcttcttcggcacgcagaccggcaccgccgagggcttcgcc
aaggcgcttgcggaggaggccaagtcgaggtacgacaaggccgtcttcaaggtgctcgat
ctggatgagtatgctgcggatgatgaggagtatgagcagaagcttaagaaggagatcatc
gccttgttcttcgtggcaacgtatggggatggggaaccaactgacaatgcggcgaggttc
tataaatggtttggagaggggaatgagagaggtgaatggttgagtaatcttcggtttggg
gtctttggcctcggaaataggcagtacgagcattttaacaaggttggaaaggtggttgac
caactcctcgctgaacaaggtggaaaacgcattgttcctcttggtcttggagatgatgat
caatgcattgaggatgacttcaatgcatggaaggaacttctatggccagaattggataaa
ttgctccgtgttgaagatgataaatcggcagcaccaactccctacacagctgctattcct
gaatatagagttgtattggtcaagccagaggaagccatgcatatcaacaaatcctttagt
ctcagtaatggtcatgctgtatatgacattcagcatccttgcagagcaaatgtggctgtg
cggcgggagcttcacacgccggcttcttaccggtcctgcattcatttagagtttgatatt
tcagggactggtcttacatatgagactggagatcatgttggtgtatatgcagaaaactgc
acagagactgtagaggaggtagaaaatctgttaggttattcaccagataccttattctca
attcatgctgaccaagaggatggcactccactttttgggggttctttgccacctcctttc
ccgtccccctgtactgtggggactgcacttgccagatatgctgaccttctgagttttcct
aagaagagtgctttaattgctttggcttcccatgcatctgatcccaaagatgctgagagg
ctaagacatctagcatctcctgctggaaagaaggagtattctcaatggatagtttcaagt
caacggagtctcttggaagttatgacagagttcccatcagcaaagcctccacttggtgtc
ttctttgcagccattgctcctcgactgcagccgagatactactcgatatcttcctcaccg
aggatgactccaacaagaattcatgtaacatgtgcgctagtgtatgggcaaacccctact
ggaaggatccataaaggagtttgttctacttggatgaagaactcgattcccttggaagag
agccaagaatgtagctgggctccaatttttgttaggcagtcaaacttcaaactgcctact
gatcctactgtgcctattataatgataggtcctggaactggtcttgcaccttttaggggc
ttcttacaggaaagattagctctaaaagagactggtgtggaactaggccatgccgtccta
ttctttgggtgcagaaatcgaaagatggacttcatatatgaggatgagctcaacaatttt
gttgagaccggtgcgctgtctgaattgattgtagccttttctcgtgagggtccttcaaag
gagtatgttcagcacaaaatggcagagaaggctcccgagatttggagcatcatttctcag
ggtggttatatttatgtctgtggtgatgcaaagggcatggcaagagatgtacaccgcaca
ctacacaccattgtgcaggaacagggttctttggacaactcaaacacagaaagctatgta
aagagcttgcagatggaagggagatacttgagagatgtctggtga

DBGET integrated database retrieval system