KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_155477Help
Entry
DICPUDRAFT_155477 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dpp00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 614 aa AA seqDB search
MDKIIIQDLHVQAVIGVNPNERIIKQNIIMTITSYRDLSKCGSTDNVAYTISYSSLSKSL
CSYAESSHHYTLEALATGVAKICCLGFGIEKVKVLIQKPGAIKLAKWPGVEIVRTLDFFK
SNSYVEIPSSNKQISAPPSNETGSSKEGLNIVYLAFGSNMGDKYENIVKSFEILKEKVNI
LETSFMYESGAQYFLEQDSFFNCVCKGSTDLKPQELLVFIKSIEEKMGRDFKMFKNGPRI
IDIDIIYYNSQILKIETLEIPHPLMWERDFVLIPLCDIAPNFMHPTLHITSNRMKMNLKP
SSIQKIFRIGKINWRWNKKTFIMGILNVTPDSFVDGGKYDSVQKSLDQATKLITQGSDII
DIGGQSTYPGAAQITIQEEIDRVVPVIKKIREKYPDIPISIDTYNHQVAKEAILAGCNLI
NDVSGAMKDPNMFLIAKEYKTPIILNHQQPTTQYLQQKQNEQNVNANTNQSSQKIDLSNP
SVITTLNNFFKERIETATKLGLYRWQLILDPGLGFYKTYEQSIEIIKKGKDLISLGFPVL
IGPSRKGFIAQTIAKYDESSNGEVPPPNSERRLYGTVACCCIAASWGVNIVRIHDINQIK
DSLLISDSIYKNQQ
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattattattcaagatttacatgtgcaagcagtaattggggtaaatccaaat
gaaagaattataaaacaaaatattattatgaccataacatcatatagagatttatccaaa
tgtggttctacagataatgttgcatatacaatctcctatagctccctatctaagtcatta
tgttcatatgcagaatcatcacatcactatacattagaagcactagcaacaggagtagca
aagatttgttgtttaggttttggtattgaaaaagttaaagtattgattcaaaagccgggt
gcaattaaattagcaaaatggccaggagtagaaattgttagaactttggactttttcaaa
tcgaactcttatgtggaaattccatcgagcaataagcaaatatctgcaccaccatcaaat
gaaaccggttcttcaaaagaggggttaaatatagtttatctagcatttggttccaatatg
ggtgataaatatgaaaatattgtaaagagtttcgaaattttaaaagaaaaggtaaatatt
ttagaaacatcttttatgtatgaaagtggtgcacaatatttcttagaacaagattcattt
ttcaattgtgtatgtaaaggatcaacagatttaaagccacaggaactattagtattcatc
aaatccatcgaagaaaaaatgggtagagattttaaaatgttcaaaaatggtccaagaatt
attgatatagatatcatctactataatagccaaattttaaaaattgaaacattagagatt
ccacatccattaatgtgggaaagagattttgttctcatacctctatgcgatattgcacca
aatttcatgcatccaacccttcacattacttcaaatcgtatgaaaatgaatttaaaacca
tcctctattcaaaagatcttcagaattggaaaaattaattggcgttggaataaaaaaaca
tttattatgggaatattaaatgtaactccagatagctttgttgatggaggcaaatacgat
agtgttcaaaagtcattggaccaagcaactaaattaatcacacagggttcagatattatt
gatataggcggccaatcaacttatcctggtgcagctcaaattacaattcaagaagaaatt
gatagagtagttccagtaattaaaaagattagagaaaagtatccagatatcccaatttca
attgacacatacaatcaccaagtagcaaaagaagcaattttagcaggttgtaacctaatc
aatgatgttagcggtgcaatgaaagatccaaatatgtttttaatcgccaaagaatataaa
actccaattatattaaatcatcaacaaccaacaactcaatatctacaacaaaaacaaaat
gaacaaaatgtgaatgctaatacaaatcaatcaagccaaaaaatagatttatcaaaccca
agtgttataacaacactaaataacttctttaaggaaagaattgaaacagcaacaaaacta
ggtctttacagatggcaattaatattagatcctggtttaggtttttataaaacatatgaa
caatccatcgaaatcatcaaaaagggtaaggatctaatatccttaggtttccctgttttg
attggtccatcaagaaaaggtttcattgctcaaaccatcgcaaaatatgatgaatcgtca
aacggtgaagttccacctccaaatagtgaaagaagactttatggaaccgttgcatgttgc
tgtattgccgcttcttggggtgttaatattgttagaattcacgatattaaccaaatcaaa
gattcattattaatttcagattccatttataaaaaccaacaataa

DBGET integrated database retrieval system