KEGG   Desulfobulbus propionicus: Despr_1842Help
Entry
Despr_1842        CDS       T01413                                 

Definition
phospholipase A(1) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
dpr  Desulfobulbus propionicus
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dpr00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:dpr00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:dpr00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:dpr00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2115318..2116334)
Genome map
AA seq 338 aa AA seqDB search
MRSLAFSLSAAGTAALIVFLSTAGLADANALDECVQSKLATADDSVTVGDLRRQCLQNAV
GVERGLPDRKGAVEQRLEAEKKNVLRPFSIMPHRPNYILPGAWNSKGYNAEHHRKANGDS
TYDFDSVEAQFQISIKTPLVVGLFDDSTDIFAAYTNHSFWQVYNDDISAAFRETNHEPEI
WVQFNPRWELLGIVNASNSFGINHQSNGQSSALSRSWNRLFASLVFEYGNLGFIATPWYR
IPESEGDDDNPDITKYMGHYELGATYKWDDHTFSLMTRNALESNYHRGSFQFSWSFPMGD
WPFLRGYVQYYNGYGESLVDYDQYVNRVGVGLSLTDWL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagatctcttgctttttccctgagtgcagccggaaccgctgccttgatcgttttcctc
tccactgccggcttggccgatgccaatgcgctggacgaatgcgtgcagagcaagctggcc
acggccgatgacagtgtcaccgtcggcgacctgcgtcggcagtgtctgcaaaacgcggtc
ggtgtcgagcgcggcctccccgaccgcaaaggcgcggtggaacagcggctggaagcggaa
aagaagaacgtgctccggccgttcagcatcatgccacaccggcccaattacatcctgccg
ggagcgtggaattcaaagggctacaatgccgagcaccatcgcaaggccaacggcgacagc
acctatgatttcgattcggtggaagcccagttccagatcagcatcaagacgccgctggtg
gtgggactgttcgacgattccaccgacatctttgccgcctacaccaaccacagcttctgg
caggtctacaacgacgacatttccgcggccttccgcgaaaccaaccacgagccggagatt
tgggtgcagttcaacccccgctgggaactactgggcatcgtcaatgccagcaattcgttt
ggcatcaaccaccaatccaacggccagagcagcgccctgtcgcgcagttggaaccggctg
ttcgcctccctggtgtttgaatacggcaacctcgggttcatcgccaccccctggtaccgc
atcccggagagcgaaggcgacgacgacaacccggatatcaccaagtacatgggacattac
gaactcggcgccacctacaagtgggacgaccacaccttcagcctgatgacccgcaacgcc
ctggagtccaactaccaccgcggttcgttccagttcagctggagttttcccatgggcgat
tggcccttcctgcgcggctatgtgcagtattacaacggctatggcgaaagcctggtcgat
tatgaccagtatgtcaaccgggtgggcgtcgggctgtcactgaccgactggctgtga

DBGET integrated database retrieval system