KEGG   Desulfotalea psychrophila: DP2094Help
Entry
DP2094            CDS       T00192                                 

Gene name
phdC
Definition
(GenBank) probable dihydrolipoamide acetyltransferase, component E2 of pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00010  Glycolysis / Gluconeogenesis
dps00020  Citrate cycle (TCA cycle)
dps00620  Pyruvate metabolism
dps01100  Metabolic pathways
dps01110  Biosynthesis of secondary metabolites
dps01120  Microbial metabolism in diverse environments
dps01130  Biosynthesis of antibiotics
dps01200  Carbon metabolism
Module
dps_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP2094 (phdC)
   00020 Citrate cycle (TCA cycle)
    DP2094 (phdC)
   00620 Pyruvate metabolism
    DP2094 (phdC)
Enzymes [BR:dps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DP2094 (phdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C Peptidase_M23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: CAG36823
UniProt: Q6ALF2
Position
complement(2384321..2385514)
Genome map
AA seq 397 aa AA seqDB search
MTEFRMPSLGADMKEGRLVEWKVKLGDQVKRGDIIAEVETAKGVIEIEVFTDGVIEQILV
QRGENVPVGTVLATIQGNGEQGRELREEALPEPVFKYKACLIAAHREEPAAEPPPAVVTA
AGKRLRISPRARKLLAELDVELSTVQGTGQGGAITGIDIERAAAAEKAAAQSVPSTPGAA
MRQAIATAMARSNREIPHYYLASRIDMSNTLRWLEAENKKRSIKERVLPVVPLIKATALA
LAKVPELNGYWLDNRQQPEEAVHIGFVISLRQGGLVAPAIHHANLKSLPELMETLSDLIT
RTRSGHLRSSELTDATVTITNLGDLGVEVVHGVIYPPQVALVGFGKILEQPWAKDGMLGI
RPILTATLAADHRATDGHRGAQFLEALNHHLQKPEEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgactgagttccgcatgcccagcctgggtgccgacatgaaagaggggcggctggtcgaa
tggaaggtcaagctgggcgatcaggtcaaacgtggcgatatcattgccgaggtggaaacc
gcaaaaggggtgatcgagatcgaggtgtttaccgacggcgtcatcgagcagatcctggtc
cagcggggcgagaatgttcccgtgggcactgtgctggcgaccatccaggggaacggagag
cagggcagggagctgagggaagaagcgttgccggaaccggtgttcaagtacaaggcctgc
ctgatcgcggcgcaccgtgaggaaccggcggcagagccgcctccggctgtggtcactgca
gcgggcaaaaggctgaggatttcgccccgggcgcgcaagctgcttgctgaactggacgtt
gaactgagcacagtccagggcacagggcagggcggcgccatcaccggcatcgacattgaa
cgtgccgcagcggcggaaaaggccgcagcccaatcggtgccatctacgccaggggccgcc
atgcggcaggccattgcaaccgcaatggcccggtccaaccgggaaattcctcattactat
ctggccagccgcatcgatatgagcaataccctgcgctggctggaggcagagaacaagaaa
cgttctatcaaggagcgggtattgcctgtggtgccgctgatcaaagccaccgccctggcc
ctggcaaaggtgccggaactcaacggttattggctcgacaatcgccaacagcccgaggaa
gcggtgcatatcggcttcgttatctcgcttcggcagggcggcctggtggcaccggccatt
caccatgccaacctcaagagcctgcccgagctgatggaaaccttgtccgacctgattacc
cgcacccgcagcggtcacctgcgcagctcggagctgaccgatgctaccgttaccataaca
aacctgggggacctgggggttgaggtggttcatggcgtcatctatcccccccaagtagcg
ctggtcgggttcggtaaaatcctggagcagccttgggccaaggacggtatgctcggcatt
cgtcccatcctgacagccactctggccgcagaccaccgtgccaccgacggccatcgcggg
gcccagtttctggaagccctcaaccaccacctgcaaaaaccggaagagttatga

DBGET integrated database retrieval system