KEGG   Danio rerio (zebrafish): 100002263Help
Entry
100002263         CDS       T01004                                 

Gene name
pik3cb, fb92a07, wu:fb92a07
Definition
phosphoinositide-3-kinase, catalytic, beta polypeptide
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100002263 (pik3cb)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100002263 (pik3cb)
   04370 VEGF signaling pathway
    100002263 (pik3cb)
   04630 Jak-STAT signaling pathway
    100002263 (pik3cb)
   04068 FoxO signaling pathway
    100002263 (pik3cb)
   04070 Phosphatidylinositol signaling system
    100002263 (pik3cb)
   04150 mTOR signaling pathway
    100002263 (pik3cb)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100002263 (pik3cb)
  Cell growth and death
   04210 Apoptosis
    100002263 (pik3cb)
  Cell communication
   04510 Focal adhesion
    100002263 (pik3cb)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100002263 (pik3cb)
  Endocrine system
   04910 Insulin signaling pathway
    100002263 (pik3cb)
   04914 Progesterone-mediated oocyte maturation
    100002263 (pik3cb)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100002263 (pik3cb)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100002263 (pik3cb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
15
AA seq 1080 aa AA seqDB search
MPPAKTDQLDLWAESGLDGDDQVMVDFLLPTGIYIQMEVPRESTIQHIKLLLWKEAQTYP
LFSLLGEMEGHMFECVNQAAVHEELEDETRRLCDVRPFLPVLKLITRNCGRAERLLDSKI
GVLIGKGLHELDALQDQEVKDFRSKMKRISEEKMQQMQMMSWGQWLRSSYSPQLDTSSLD
NLIERHEGIIKITMHYDQSQDTASLKVSLNCTVSEVMDHALKKWQTTHGPEEDIGARSNY
VLRVSDRLEFLFEDYPLIQYKYIRACLSTGENPHLTVVHFDIVKSMFEKEIATVGSVLAR
KTSNPPLPLPPKKRQTTVRTSSMSASQLPQQLHTCVWKVHSLFRINLVKANKVNAEDAAK
IQVRAGLFHGTELLCKTAVSNESSSRSEHVWNKTLEFDIPVCDLPRMARLCFAIYAVMDK
VKKQRSTKNTHLNKYQTIRKAGKVHYPIAWVNTMVFDYRGQLKTGDIILHCWSSFPDELE
EMLNPIGTIQTNPYTENATELHISFPEYSTQPVVFPAFDKILEKAAEIAGASDSMSMGRG
GKKFYIELKEIMERDPLSQLCENEKDLIWTLRYDCRENFPQSLPKLLLSVKWSKHEDMAQ
LQALLQIWPKLSPRDALELLDFNYPDQYVREFAVSCLKDMSDDELLQYLLQLVQVLRYEP
YYDCSLSRFLLERAQTSRKIGHFLFWHLRSEMYMPAVSVHFALILEAYCRGCIPHIEVLK
KQVEALNKLKAVNELIKLGTIKTKTKQAHLKEAMMSCLRQTGFIETLSDLHSPLNPNILL
AGVSVEKCKYMDSKMKPLWIVYNNKLLGGETVGIIFKNGDDLRQDMLTLQILKLMDLLWK
EANLDLRIVPYGCLATGDHSGLIEVVSSADTIANIQKTSSNMAAAAAFNKDALLNWLKDK
NSGDALDKAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSK
FGIKRERVPFILTHDFIHVIQEGKTGNTEKFGNFRQYCEEAYMILRKNGNLFITLFALML
TAGLPELTSVKDIQYLKDSLALGKTDEEALKQFRQKFDEALRESWTTKVNWMAHIVAHPS
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccgcaaagacagatcagctggacttgtgggcggagtcggggttagatggagac
gaccaggttatggtggacttcctgttgcccactggaatctacatccagatggaagtccct
cgcgagagtaccatccaacacatcaaactgctattatggaaggaggcgcagacatatcct
ctcttctcattgctgggggagatggagggtcacatgttcgaatgcgtgaaccaggcagca
gtgcacgaggagctggaggatgagaccaggcgactatgtgatgtgcgaccattcctgcct
gttctcaaactgatcacacgtaattgtggacgtgcagagcgcctcctagattccaagatt
ggagttctcattggaaaaggtcttcatgagttggatgccctgcaagaccaggaagtaaaa
gactttcgttccaaaatgaaaagaatcagcgaagagaaaatgcagcaaatgcaaatgatg
tcatgggggcagtggcttcgcagctcttattccccacagctggacacaagctcattggat
aatttgattgagaggcatgagggcataattaaaatcaccatgcactacgaccagtcacag
gacacagccagcctgaaagtatcgttgaattgtacagtatctgaagtaatggatcatgct
ctcaagaaatggcagactactcatgggccagaggaagacattggtgcccgtagcaattat
gtgctgcgtgtcagtgatagacttgagttcctgtttgaagattatcctcttatacagtac
aaatacattagggcttgtttgtcgaccggtgaaaaccctcatctaacagtggttcacttt
gacatagtgaagagcatgtttgagaaggaaatcgctactgttggctcagtgcttgcaagg
aagacctcaaaccctccgctaccactgcccccaaagaagagacaaacaactgtaaggaca
tcgagtatgtctgcgtctcagttaccacaacaacttcatacatgtgtttggaaggttcat
tctctgtttagaattaatcttgtgaaagctaacaaggtgaacgctgaagatgctgctaag
atccaggttcgagcaggactttttcatggtacagagttgttgtgcaagacagctgtcagc
aatgagagcagcagtcgatctgaacatgtgtggaacaaaacactggagtttgacattcct
gtttgtgatctgccacggatggcccgcctctgctttgcaatttatgctgttatggataaa
gtgaaaaaacagagatccacaaagaacacacacctgaacaaataccagactatccgcaag
gcagggaaagtacactacccaattgcatgggtgaatactatggtatttgactacagaggg
cagctgaaaactggtgacattatcctccactgttggtcatcatttcctgatgagctggaa
gagatgttgaaccctatcggcaccattcagaccaatccatacacagagaatgccacagag
ctacatataagctttccagaatactcaacgcaaccagttgtttttcctgcttttgacaag
atcctggaaaaagctgcagaaatagctggagccagtgattccatgtcaatgggtcgtggg
ggtaaaaagttttacatagagctgaaggagatcatggagagggatcctctttctcagctg
tgtgagaatgagaaggatctgatctggacacttcgctatgactgcagagaaaattttcct
cagtctctccctaaacttctactctctgtcaaatggagcaaacatgaagacatggctcag
ctacaagctttgctgcagatttggcctaagctgagtcctcgtgatgctttggaacttctg
gacttcaactatccagaccagtatgtcagagaatttgcagtcagctgcctcaaagatatg
agtgatgatgagctgttgcagtatctgctgcagcttgtgcaggtgttgcgctatgagcca
tactatgactgcagcctcagccgtttcctcctagaacgtgctcagaccagccgtaaaatt
ggtcatttcctcttctggcatctcaggtctgaaatgtacatgccagctgtatcggttcat
tttgctctgatcttggaagcctactgcagaggctgcatcccacacattgaagttctcaaa
aaacaggttgaagctctcaataagctgaaagcagtaaatgagttgataaaactgggcact
ataaaaacgaagacaaagcaagctcatctgaaagaggccatgatgtcatgcctaagacag
acaggattcatcgagacactctccgatttgcattctcccctcaacccaaacatattgctt
gctggagtcagtgtggagaagtgcaagtacatggactctaagatgaaacctctgtggatc
gtttacaataacaagttgctgggaggagagacagtgggcatcatctttaaaaatggagat
gatctgaggcaagatatgttgactctacagattttaaagttgatggatctgctgtggaaa
gaggccaacctggacctcagaattgtgccttatggttgcttggcgacaggagatcattct
ggactcatcgaggtagtatcttcagctgacaccattgcgaacatccaaaaaacaagcagc
aacatggctgctgctgccgccttcaataaagacgctctgctaaactggcttaaagataaa
aactctggggatgctttggacaaagccattgaggagttcactctatcatgtgctggttat
tgtgttgccacctatgtcttgggcattggtgatcgccacagtgacaacataatggtccgc
agtacagggcagcttttccacatagattttgggcacatactgggaaactttaagtctaag
tttgggattaagcgggaacgtgttcctttcatcctcacacatgacttcatccacgtgatt
caagagggaaaaacaggcaacacagagaaatttggaaattttaggcaatattgtgaggag
gcatatatgattctgagaaagaatggaaatctgttcatcacactctttgctctcatgctc
accgcaggcctaccagagctcacgtctgtcaaagatatacagtatttaaaggactctctg
gcattaggcaaaactgatgaggaggccctcaaacagttccggcagaagtttgatgaagct
ctgcgagagagttggaccaccaaagtcaactggatggcccacattgtggctcacccttca
taa

DBGET integrated database retrieval system