KEGG   Danio rerio (zebrafish): 322543Help
Entry
322543            CDS       T01004                                 

Gene name
apoa4b.1, apoa4, wu:fb64f03, wu:fb66f09, zgc:122983
Definition
apolipoprotein A-IV b, tandem duplicate 1
Orthology
K08760  
apolipoprotein A-IV
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 255 aa AA seqDB search
MKLYLILAFVAFTGCQANLFYADEPKPQLEQLTDAFWSYVSKATQTAEETVKMIRESQLG
QEVNERLTQSADMASEYAVTLKKQVDPLTEELMNKITKETEVLRERLGQDLINVREKLEP
YADNMKSQIQQRVEELRAAMAPYADSLDSETLKATLLQKSEELRGNLEQSVKELQAQLEP
YTAELKEKVDQHLQEFQETVSPLAEDLQVQIRERAQIVQQSLTPYAEDLKEKLDPYAQNL
KDQLISLYDSFTKRY
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtatctgatacttgcctttgtggcattcacaggctgccaggccaacctattc
tatgctgatgagcccaaaccacagctggagcagctgacagatgcattctggagctatgtt
tccaaagcaacacaaactgcagaggaaaccgtcaagatgatcagagagtctcaactgggt
caagaagtcaatgaaagactgacccagagtgctgatatggccagtgaatacgccgtcacc
ctcaagaaacaggtggatcctctgactgaagagctgatgaacaaaatcaccaaggagact
gaagtgctgagggagcgtctgggccaggacctgatcaacgtgagagagaaactcgagccc
tatgctgacaacatgaagagccagatccagcagagagtggaggagctcagggcggccatg
gctccgtatgctgactccctggattctgaaaccctgaaggccactctgctccagaagagc
gaggagctgagaggaaacctggagcagagcgtgaaggagctgcaggctcagctggagccc
tacactgctgaactcaaggagaaagtggaccagcatctgcaggagttccaggaaactgtg
agtcctctagctgaggatctgcaggtccagattagagagagagcccagattgtccagcag
agtctcacaccctatgctgaagaccttaaggagaagctggacccctatgcacaaaaccta
aaagaccagctgatctctctgtacgattctttcaccaagagatattaa

DBGET integrated database retrieval system