KEGG   Danio rerio (zebrafish): 327253Help
Entry
327253            CDS       T01004                                 

Gene name
hdac10, wu:fd19e10, zgc:55652
Definition
histone deacetylase 10 (EC:3.5.1.98)
Orthology
K18671  
histone deacetylase 10 [EC:3.5.1.98]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     327253 (hdac10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
25
AA seq 676 aa AA seqDB search
MASGSALIFDEEMSRYKLLWTDPACEIEVPERLTVSYEALRTHGLAQRCKAVPVRQATEQ
EILLAHSEEYLEAVKQTPGMNVEELMAFSKKYNDVYFHQNIYHCAKLAAGATLQLVDSVM
KREVRNGMALVRPPGHHSQRSAANGFCVFNNVAFAALYAKKNYNLNRILIVDWDVHHGQG
IQYCFEEDPSVLYFSWHRYEHQSFWPNLPESDYSSVGKGKGSGFNINLPWNKVGMTNSDY
LAAFFHVLLPVAYEFDPELVIVSAGFDSAIGDPEGEMCALPEIFAHLTHLLMPLAAGKMC
VVLEGGYNLTSLGQSVCQTVHSLLGDPTPRISGLGTACDSALESIQNVRNVQSSYWSSFK
HLAQSETNPKRPRLDATNGGPKESSEPASESNPKKTAQDIVWPEPLKRMPASVRTVVVPP
PGVELTLPKNCQHSGDISESTAKEVQRIRDKHFHDLTDQNILRSLGNIISVLDRMMRSDE
VCNGCVVVSDLSVSVQCALQHALTEPAERVLVVYVGDGELPVKTNDGKVFLVQICTKETE
DKCVNRLTLCLREGESLTAGFMQALLGLILPVAYEFNPALVLGIVEETAAKTRLMRVWGH
MTCLIQGLARGRMLTLLQGYDKDLLELTVSALSGASISPLGPLRAPKPEDVEMMEKQRQR
LQERWGLLRCTVSESW
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaggaagcgcgctgatctttgacgaggagatgagccgttataaactcctctgg
acagatccagcatgtgagattgaggtgcctgagcggttgaccgtgtcctatgaagcgctc
aggacacatggtttggcccagaggtgtaaagcggtgcccgtccgccaggccacagagcag
gagattttactcgcacacagtgaggagtacctggaggcggtcaaacagacgccaggcatg
aacgtagaggagctgatggcgttttccaagaaatacaatgatgtctattttcaccagaac
atttatcactgtgcgaagctggcggcgggagcaactctgcagctggtggacagtgtcatg
aagagagaggtcagaaacggcatggcgctggtcaggcctccaggacaccacagccagcgc
tctgctgccaacggtttctgtgtgttcaataacgtggccttcgctgctctttatgccaag
aaaaactacaatctgaacaggattttgattgtggactgggacgtccatcatggacagggg
atccagtactgcttcgaggaggatccaagtgtgctttatttctcctggcatcgctatgaa
caccagagcttttggcccaatctcccagagtcagactacagcagcgtagggaaaggaaaa
ggatccggatttaacattaacctcccctggaacaaggtgggaatgaccaacagcgactat
ctggctgctttcttccacgttcttttacctgttgcatacgagtttgatcctgagctggtt
attgtcagcgctggttttgattcagccatcggggacccagaaggtgaaatgtgtgctctt
cctgagatctttgcacacctcactcatctgctgatgcctttggctgcaggaaaaatgtgt
gtcgttctggagggaggatacaacctgacctctcttggccagtcagtttgccaaaccgtc
catagtcttctcggagatccaacaccacgaatttcaggactcggcaccgcatgtgatagt
gcactggaatcgatacaaaatgttcgcaatgtgcagtcttcatactggagcagttttaaa
cacttggctcaatcagaaacaaaccccaaacgtccccgactggacgcaacgaacggagga
ccaaaagagtcttcagaacctgcatcagagagcaatcctaagaagacggcgcaggatata
gtgtggcccgagcctttaaaaaggatgcctgcatctgtgcgcacagtggtagtgcctcct
cctggtgtggagctcacactgccgaagaactgccaacattcgggggacatttccgaaagt
actgctaaagaagtacaacgcattcgggataaacatttccatgacttaacagaccaaaac
atcctccggtctcttggaaatattatttcagttcttgaccgaatgatgaggagtgacgag
gtgtgtaacggatgtgttgtggtgtcagatttgagtgtttctgttcagtgtgctcttcaa
cacgcactaactgaacctgctgaacgggtgctggttgtttatgttggagatggagagtta
cctgtcaaaactaatgatggaaaggtgttcctagtccagatctgcactaaagaaactgaa
gataagtgcgtgaaccgtctcaccttgtgtctgagagagggtgagagtttgactgcaggt
ttcatgcaggctcttctgggcctgattctgccagtggcgtatgagtttaacccggctctg
gtgctcgggattgtggaagaaactgcagcaaagactaggcttatgagagtctggggtcac
atgacctgcctaatccaaggcctggccagaggacggatgctcacactactgcagggctat
gataaagatctgctggagctcacagtctctgctctctctggggcctctatcagtcccctt
ggacccctgagggccccaaaacctgaggatgttgagatgatggagaagcagagacagagg
ctgcaggaacgctggggtttactgcgctgcacagtttcagagagctggtga

DBGET integrated database retrieval system