KEGG   Danio rerio (zebrafish): 373867Help
Entry
373867            CDS       T01004                                 

Gene name
plcg1, fj46f04, wu:fj46f04, wu:fj57a05
Definition
phospholipase C, gamma 1 (EC:3.1.4.11)
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    373867 (plcg1)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    373867 (plcg1)
   04370 VEGF signaling pathway
    373867 (plcg1)
   04020 Calcium signaling pathway
    373867 (plcg1)
   04070 Phosphatidylinositol signaling system
    373867 (plcg1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     373867 (plcg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
23
AA seq 1312 aa AA seqDB search
MAASAGFSSNGPVPWALSDTEVNNLYRDLELGTVLTLYYSKKSQRPERRTFQVKLETRQI
IWTRGTDKIEGEIDIREIKEIRTGQKSRDFERYVEDVTTRPDQAHCFVILYGTEFRLKSL
SLAATSDEEMVMWVKGLTWLMSDTLSSSTPLQIERWLRKQFYAVDRNREDRISCKDLKCM
LCQVNYRVPNMKFLREKLPDGELRNGDVSYSHFAQLYRSLMFDAQKSMEIPLLQRFIDRP
EQKISLEDFQNFLIEQQKELWAADSNKVQEYMFRYLKDPLREIEQPYFHQDEFLTYLFSK
ENTIWDAQLDQVRPEDMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIE
LDCWDGPDGMPVIYHGHTLTTKIKFSDVLNTIKEHAFVTSDYPIILSIEDHCSIVQQRNM
ATFFKKVFGEMLLTKAVDISADGLPSPHQLKRKILIKHKKLAEGSAYEEVSSSTPYSEND
ISNSIKNGILYLEDPINHEWYPHFFVLTSNKIYYSEETSSNQGNEDEEEHREICNGMDQH
VTEKWFHGKLGAGRDGRQIAERLLSEYCVETGAPDGSFLVRESETFVGDYTLSFWRSGRV
QHCRIHSRQEAGSPKFYLTDNLVFDTLFALITHYQQVPLRCNEFEMKLTEPVPQTNAHES
KEWYHACLSRSQAENMLMRVPRDGAFLVRKRTEFNSFAISFRAEGKIKHCRVQQEGQTVV
LGTSEFDSLVDLISYYEKHPLYRKMKLRYPINEETLEKIGTAEPDYGSLYEGRNPGFYVE
ANQMPTFKCTVKAMYEYKAQRDDELSFIKNAIISNVDKQEGGWWKGDCGGKKQLWFPANY
VEEISPTAVEPDRSASENSPLGDLLRGSVDVSSCQIVVRPEGKGSRQFVFSLVPVASPRT
GPVLDIAASSQEELKDWVVKIREVTMTSEAKLEEGKMMERRKKIALELSDLVIYCRPVPF
DEDKIGTERACFRDMSSFPETKAEKYVNRVKGKKFLQYNRLQLSRIYPRGQRLDSSNYDP
LPMWLCGSQLVALNFQTADKPMQMNQAIFMLNGRSGYVLQPPIMRDDNFDPFDRHSLRGV
EPITLSIEVLGARHLPKHGRGIVCPLIEIEVCGAEYDNAKQRTDSEADNGLNPTWTRKLF
RFTVCNPSFAFLRFVVYEIDMFSDQNFLAQATFPINCLKTGYRSVPLKNSYSEDLELACL
LVHMDVIRGRVGYEMIHENGDMLSPFSPAGAMAMAMQTGRERMNDSGSVSSTSSMSPLPS
SPAQALGYRGREGSFEARYQTPLEDFRVSQEALLDHENRRLRRARVSADNRA
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgagcgcgggcttctcctccaatggacctgtaccctgggctctgagcgacacc
gaggtgaacaatctgtaccgggatctggagctgggcaccgtactcacgctctattactcc
aaaaagtcccagagacccgagaggaggacgtttcaagtcaagctcgagaccaggcagatt
atctggaccagaggaacggataaaatcgagggcgaaattgatatccgggagattaaggag
atccggactggacagaagtctcgggactttgagcgatatgtggaggacgtcacgacccgg
ccggaccaggcccactgcttcgtcatcctctacggcactgagtttcgcctcaaatccctc
agtctggcagcgacctcagacgaggagatggtgatgtgggtgaagggtctgacgtggctg
atgtccgatacgctgagctcctccacaccgctgcagattgaaaggtggctgagaaagcag
ttttacgcagtggatcgtaaccgagaggacagaatttcctgtaaggatctgaaatgtatg
ttgtgtcaggtcaactacagagtgcccaacatgaagttcctccgagagaaacttccggac
ggcgagctgaggaatggagacgtgtcgtacagtcatttcgctcagctataccgcagtctg
atgttcgacgcacagaaatcgatggagattccactgctgcagaggtttattgacagaccg
gagcagaagatctcgctcgaggacttccagaacttcctcattgaacagcagaaggagctg
tgggctgcagacagtaataaggtgcaggagtacatgttccgctacctgaaggatcctctg
agagagatcgaacagccctactttcaccaggacgagttcctcacctatctgttctccaaa
gaaaacaccatctgggacgctcagctggatcaggtgcggcccgaggacatgaacaacccc
ctgtcccactactggatctcctcgtcccacaacacctatctgacgggggaccagttttcc
agcgagtcgtctctggaggcgtacgcccgctgtctgcgcatgggctgcagatgcatcgag
ttggactgctgggacggtcctgacgggatgcctgtcatctatcacggtcacaccctcacc
accaagatcaagttcagtgatgtgctcaacaccatcaaagagcacgcattcgtcacgtct
gactatcccatcatcctctccatcgaggaccactgcagcatcgtccagcagagaaacatg
gccactttcttcaagaaggtgtttggggagatgctgctgaccaaagcggtggacatttca
gcagacggcctgccctcgccacaccagctcaagaggaagatcctcatcaagcacaagaag
ttagcggagggcagtgcgtacgaggaggtgtcgtcttcaacaccctactcagagaacgac
atcagcaactccatcaagaacggcatcctgtacctggaggaccccatcaaccacgagtgg
tatccacacttctttgttctgaccagcaataagatctattactctgaagagacgtccagt
aatcaagggaacgaggatgaggaggagcacagagagatctgcaacggtatggaccagcat
gtgacggagaagtggtttcatggtaaactgggtgcaggtcgtgacggccgtcagatcgca
gagcgcttgctgtctgagtactgcgtggagactggagctccagacggatccttcctagtg
cgggagagcgagacctttgtaggagactacaccctctccttctggcgctctggtcgtgtt
cagcactgcaggattcactctcgacaggaagcaggaagtcccaagttctacctgacggat
aacctggtgttcgacactctgtttgcgctcatcactcattaccagcaggttcctctgcgc
tgcaacgagttcgagatgaagctgaccgagccggtgccgcaaaccaacgctcacgagagc
aaagagtggtaccacgcgtgtctgtcccgcagtcaggctgaaaacatgttgatgagggtc
ccacgtgacggtgctttccttgttaggaagagaactgaattcaactctttcgccatttcc
ttccgggctgaagggaagatcaagcactgtcgcgtccagcaggagggacagacggtggtt
ttgggaacctcggagttcgacagtttagtcgatttaatcagttactatgagaaacatcca
ctgtaccgcaagatgaagctgcgctaccccatcaacgaggaaacactggagaagatcggc
actgctgagcctgattatgggtctctgtatgagggacgaaacccgggattctatgtggaa
gccaatcagatgcccacatttaagtgcacagttaaagccatgtatgaatacaaagcccag
cgggatgatgagctctctttcatcaagaacgccatcattagtaacgtggacaaacaggag
ggaggctggtggaagggtgactgcggtggaaagaagcaactgtggttcccggccaattat
gtggaggagatcagcccgacggcggtggagcccgacagatctgcctcagagaacagtcct
ctgggagatctcctgagaggaagtgtggacgtgtcttcctgtcagatcgtggtcagacct
gaagggaaaggcagtcgtcagttcgtcttctctctggtgccggtggcgtctcctcgcacc
ggtcctgtgctggacatcgcagccagctctcaggaggagctgaaggactgggtggtgaag
atccgagaggtcaccatgacatctgaagccaagcttgaagaggggaaaatgatggagaga
agaaagaagatcgctttagagctgtctgatctggtcatctactgccggccggttcctttt
gatgaagacaaaattgggacggagcgcgcctgtttccgggacatgtcctcctttcccgag
actaaagcagagaagtatgtgaaccgcgttaaagggaagaagttcctgcagtataaccgt
ctgcagctctcgcggatctacccgcgcggccagcgcctcgactcctccaactacgaccca
ttacccatgtggctgtgcggcagtcagctggtggccctcaacttccagaccgcagataaa
cccatgcagatgaaccaggccatcttcatgctgaacggcaggagtggatatgtgctgcag
ccgcccatcatgagggatgacaacttcgacccgtttgaccgccactcgctcagaggagtg
gagcccatcacactcagcatagaggttttgggagcgcgtcacctgcccaaacacggtcga
ggtattgtttgtccgctcatcgagattgaagtttgcggagcagaatatgacaatgccaag
cagaggacagactcagaagcagacaatggtctgaaccccacctggaccaggaaactcttt
aggttcaccgtgtgcaatccttccttcgcattcctgcgctttgtggtctacgaaatcgac
atgttcagtgaccagaactttctggcccaggccacattccccatcaactgcctcaaaaca
ggctaccgctcggtcccgctgaagaacagctacagtgaggatctggagctggcctgtctg
ctggtgcacatggacgtcatcagaggacgggtgggatatgagatgatccatgagaatgga
gacatgttgagtccgttctctccggctggggcgatggcgatggctatgcagacgggccgc
gagcggatgaacgactctggctccgtctcctccacctcctccatgtctcctctgccctcg
tctccggcgcaggctctagggtaccgcgggcgcgagggctcgttcgaggcccgctatcag
acccctctggaggacttcagagtgtctcaggaggcgctgctggaccacgagaacaggagg
ctccgcagggctcgcgtcagcgccgataaccgagcgtaa

DBGET integrated database retrieval system