KEGG   Danio rerio (zebrafish): 373867Help
Entry
373867            CDS       T01004                                 

Gene name
plcg1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00562  Inositol phosphate metabolism
dre01100  Metabolic pathways
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04370  VEGF signaling pathway
dre04933  AGE-RAGE signaling pathway in diabetic complications
Module
dre_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    373867 (plcg1)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    373867 (plcg1)
   04370 VEGF signaling pathway
    373867 (plcg1)
   04020 Calcium signaling pathway
    373867 (plcg1)
   04070 Phosphatidylinositol signaling system
    373867 (plcg1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    373867 (plcg1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     373867 (plcg1)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    373867 (plcg1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    373867 (plcg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y PH SH3_1 C2 SH3_9 SH3_2 PH_12 GDPD EF-hand_like
Motif
Other DBs
NCBI-GeneID: 373867
NCBI-ProteinID: NP_919388
ZFIN: ZDB-GENE-030421-3
Ensembl: ENSDARG00000038442
Vega: OTTDARG00000030387
UniProt: Q804J6
Position
23
AA seq 1312 aa AA seqDB search
MAASAGFSSNGPVPWALSDTEVNNLYRDLELGTVLTLYYSKKSQRPERRTFQVKLETRQI
IWTRGTDKIEGEIDIREIKEIRTGQKSRDFERYVEDVTTRPDQAHCFVILYGTEFRLKSL
SLAATSDEEMVMWVKGLTWLMSDTLSSSTPLQIERWLRKQFYAVDRNREDRISCKDLKCM
LCQVNYRVPNMKFLREKLPDGELRNGDVSYSHFAQLYRSLMFDAQKSMEIPLLQRFIDRP
EQKISLEDFQNFLIEQQKELWAADSNKVQEYMFRYLKDPLREIEQPYFHQDEFLTYLFSK
ENTIWDAQLDQVRPEDMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIE
LDCWDGPDGMPVIYHGHTLTTKIKFSDVLNTIKEHAFVTSDYPIILSIEDHCSIVQQRNM
ATFFKKVFGEMLLTKAVDISADGLPSPHQLKRKILIKHKKLAEGSAYEEVSSSTPYSEND
ISNSIKNGILYLEDPINHEWYPHFFVLTSNKIYYSEETSSNQGNEDEEEHREICNGMDQH
VTEKWFHGKLGAGRDGRQIAERLLSEYCVETGAPDGSFLVRESETFVGDYTLSFWRSGRV
QHCRIHSRQEAGSPKFYLTDNLVFDTLFALITHYQQVPLRCNEFEMKLTEPVPQTNAHES
KEWYHACLSRSQAENMLMRVPRDGAFLVRKRTEFNSFAISFRAEGKIKHCRVQQEGQTVV
LGTSEFDSLVDLISYYEKHPLYRKMKLRYPINEETLEKIGTAEPDYGSLYEGRNPGFYVE
ANQMPTFKCTVKAMYEYKAQRDDELSFIKNAIISNVDKQEGGWWKGDCGGKKQLWFPANY
VEEISPTAVEPDRSASENSPLGDLLRGSVDVSSCQIVVRPEGKGSRQFVFSLVPVASPRT
GPVLDIAASSQEELKDWVVKIREVTMTSEAKLEEGKMMERRKKIALELSDLVIYCRPVPF
DEDKIGTERACFRDMSSFPETKAEKYVNRVKGKKFLQYNRLQLSRIYPRGQRLDSSNYDP
LPMWLCGSQLVALNFQTADKPMQMNQAIFMLNGRSGYVLQPPIMRDDNFDPFDRHSLRGV
EPITLSIEVLGARHLPKHGRGIVCPLIEIEVCGAEYDNAKQRTDSEADNGLNPTWTRKLF
RFTVCNPSFAFLRFVVYEIDMFSDQNFLAQATFPINCLKTGYRSVPLKNSYSEDLELACL
LVHMDVIRGRVGYEMIHENGDMLSPFSPAGAMAMAMQTGRERMNDSGSVSSTSSMSPLPS
SPAQALGYRGREGSFEARYQTPLEDFRVSQEALLDHENRRLRRARVSADNRA
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgagcgcgggcttctcctccaatggacctgtaccctgggctctgagcgacacc
gaggtgaacaatctgtaccgggatctggagctgggcaccgtactcacgctctattactcc
aaaaagtcccagagacccgagaggaggacgtttcaagtcaagctcgagaccaggcagatt
atctggaccagaggaacggataaaatcgagggcgaaattgatatccgggagattaaggag
atccggactggacagaagtctcgggactttgagcgatatgtggaggacgtcacgacccgg
ccggaccaggcccactgcttcgtcatcctctacggcactgagtttcgcctcaaatccctc
agtctggcagcgacctcagacgaggagatggtgatgtgggtgaagggtctgacgtggctg
atgtccgatacgctgagctcctccacaccgctgcagattgaaaggtggctgagaaagcag
ttttacgcagtggatcgtaaccgagaggacagaatttcctgtaaggatctgaaatgtatg
ttgtgtcaggtcaactacagagtgcccaacatgaagttcctccgagagaaacttccggac
ggcgagctgaggaatggagacgtgtcgtacagtcatttcgctcagctataccgcagtctg
atgttcgacgcacagaaatcgatggagattccactgctgcagaggtttattgacagaccg
gagcagaagatctcgctcgaggacttccagaacttcctcattgaacagcagaaggagctg
tgggctgcagacagtaataaggtgcaggagtacatgttccgctacctgaaggatcctctg
agagagatcgaacagccctactttcaccaggacgagttcctcacctatctgttctccaaa
gaaaacaccatctgggacgctcagctggatcaggtgcggcccgaggacatgaacaacccc
ctgtcccactactggatctcctcgtcccacaacacctatctgacgggggaccagttttcc
agcgagtcgtctctggaggcgtacgcccgctgtctgcgcatgggctgcagatgcatcgag
ttggactgctgggacggtcctgacgggatgcctgtcatctatcacggtcacaccctcacc
accaagatcaagttcagtgatgtgctcaacaccatcaaagagcacgcattcgtcacgtct
gactatcccatcatcctctccatcgaggaccactgcagcatcgtccagcagagaaacatg
gccactttcttcaagaaggtgtttggggagatgctgctgaccaaagcggtggacatttca
gcagacggcctgccctcgccacaccagctcaagaggaagatcctcatcaagcacaagaag
ttagcggagggcagtgcgtacgaggaggtgtcgtcttcaacaccctactcagagaacgac
atcagcaactccatcaagaacggcatcctgtacctggaggaccccatcaaccacgagtgg
tatccacacttctttgttctgaccagcaataagatctattactctgaagagacgtccagt
aatcaagggaacgaggatgaggaggagcacagagagatctgcaacggtatggaccagcat
gtgacggagaagtggtttcatggtaaactgggtgcaggtcgtgacggccgtcagatcgca
gagcgcttgctgtctgagtactgcgtggagactggagctccagacggatccttcctagtg
cgggagagcgagacctttgtaggagactacaccctctccttctggcgctctggtcgtgtt
cagcactgcaggattcactctcgacaggaagcaggaagtcccaagttctacctgacggat
aacctggtgttcgacactctgtttgcgctcatcactcattaccagcaggttcctctgcgc
tgcaacgagttcgagatgaagctgaccgagccggtgccgcaaaccaacgctcacgagagc
aaagagtggtaccacgcgtgtctgtcccgcagtcaggctgaaaacatgttgatgagggtc
ccacgtgacggtgctttccttgttaggaagagaactgaattcaactctttcgccatttcc
ttccgggctgaagggaagatcaagcactgtcgcgtccagcaggagggacagacggtggtt
ttgggaacctcggagttcgacagtttagtcgatttaatcagttactatgagaaacatcca
ctgtaccgcaagatgaagctgcgctaccccatcaacgaggaaacactggagaagatcggc
actgctgagcctgattatgggtctctgtatgagggacgaaacccgggattctatgtggaa
gccaatcagatgcccacatttaagtgcacagttaaagccatgtatgaatacaaagcccag
cgggatgatgagctctctttcatcaagaacgccatcattagtaacgtggacaaacaggag
ggaggctggtggaagggtgactgcggtggaaagaagcaactgtggttcccggccaattat
gtggaggagatcagcccgacggcggtggagcccgacagatctgcctcagagaacagtcct
ctgggagatctcctgagaggaagtgtggacgtgtcttcctgtcagatcgtggtcagacct
gaagggaaaggcagtcgtcagttcgtcttctctctggtgccggtggcgtctcctcgcacc
ggtcctgtgctggacatcgcagccagctctcaggaggagctgaaggactgggtggtgaag
atccgagaggtcaccatgacatctgaagccaagcttgaagaggggaaaatgatggagaga
agaaagaagatcgctttagagctgtctgatctggtcatctactgccggccggttcctttt
gatgaagacaaaattgggacggagcgcgcctgtttccgggacatgtcctcctttcccgag
actaaagcagagaagtatgtgaaccgcgttaaagggaagaagttcctgcagtataaccgt
ctgcagctctcgcggatctacccgcgcggccagcgcctcgactcctccaactacgaccca
ttacccatgtggctgtgcggcagtcagctggtggccctcaacttccagaccgcagataaa
cccatgcagatgaaccaggccatcttcatgctgaacggcaggagtggatatgtgctgcag
ccgcccatcatgagggatgacaacttcgacccgtttgaccgccactcgctcagaggagtg
gagcccatcacactcagcatagaggttttgggagcgcgtcacctgcccaaacacggtcga
ggtattgtttgtccgctcatcgagattgaagtttgcggagcagaatatgacaatgccaag
cagaggacagactcagaagcagacaatggtctgaaccccacctggaccaggaaactcttt
aggttcaccgtgtgcaatccttccttcgcattcctgcgctttgtggtctacgaaatcgac
atgttcagtgaccagaactttctggcccaggccacattccccatcaactgcctcaaaaca
ggctaccgctcggtcccgctgaagaacagctacagtgaggatctggagctggcctgtctg
ctggtgcacatggacgtcatcagaggacgggtgggatatgagatgatccatgagaatgga
gacatgttgagtccgttctctccggctggggcgatggcgatggctatgcagacgggccgc
gagcggatgaacgactctggctccgtctcctccacctcctccatgtctcctctgccctcg
tctccggcgcaggctctagggtaccgcgggcgcgagggctcgttcgaggcccgctatcag
acccctctggaggacttcagagtgtctcaggaggcgctgctggaccacgagaacaggagg
ctccgcagggctcgcgtcagcgccgataaccgagcgtaa

DBGET integrated database retrieval system